DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ZBTB14 and CG31365

Sequence 1:NP_001137295.1 Gene:ZBTB14 HGNCID:12860 Length:449 Species:Homo sapiens
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:571 Identity:132/572 (23%)
Similarity:206/572 (36%) Gaps:172/572 (30%)


Human     8 SETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIV--------VEDVKFRAHRCVLAACSTYFKKL 64
            |.....:.||:        :|..||.| ..||.:        :||.|:|.......|...:.:.:
  Fly    97 SRVFSKDPDDY--------DEDELEFE-DSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHKRLV 152

Human    65 FKKLEVDSSSVIEI---------DFLRSDIFEEVLNYMYTAKISVKKEDV---NLMMSSGQILGI 117
            ..:||:.:....|:         ..:|.::.|||.:.:.....:...||:   .|.|..|: |.:
  Fly   153 KSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGE-LEV 216

Human   118 RFLDKLCS--QKRDVSSP--------DENNGQSKSKYCLKINRPIGD----AADTQDDDVEE--- 165
            ...:|...  :..|.|.|        |.:..:||:|...|....:.|    |.:.:.|..||   
  Fly   217 YLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFI 281

Human   166 IGDQDD--SPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESME---- 224
            :|...|  :.||..::|              |.:.|.:..|.| |:.|::|..|.:|...:    
  Fly   282 LGCNTDPANNSDVNIDG--------------LELDEEVPAESG-EDFREINMVGSDVVHTDNGEI 331

Human   225 ---------------TPE-SKDLG----------------------------------SQTPQAL 239
                           ||| .:|.|                                  ||..|..
  Fly   332 YIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVF 396

Human   240 TFNDGMSEV------KDEQTPGWTTAASDMKF--------------------------------E 266
            :|::.:..|      :|||||.....:|::.|                                :
  Fly   397 SFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQ 461

Human   267 YLLYGHHREQI-----------ACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHL 320
            .||..||...|           .|.:|....|....|::|..:||..:||.|..|...|:.:..|
  Fly   462 KLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVL 526

Human   321 KEHLKIHTGYKPYSCEVCGKSFIRAPDLKKH-ERVH-SNERPFACHMCDKAFKHKSHLKDHERRH 383
            |.|:..|||.|.:.|..|...|.:..:|::| .||| .|.|...||:|.::|.|.|.|..|...|
  Fly   527 KRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTH 591

Human   384 RGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAA 434
            .|.. |.|..|.:.|...|.::||...||..:.::|...  |||.:.||.|
  Fly   592 AGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNKLTDYI--SETNEFQAVA 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZBTB14NP_001137295.1 BTB_POZ_ZBTB14 18..131 CDD:349513 26/135 (19%)
Nuclear localization signal. {ECO:0000255} 50..66 1/16 (6%)
C2H2 Zn finger 279..299 CDD:275368 5/20 (25%)
SFP1 <303..383 CDD:227516 30/82 (37%)
C2H2 Zn finger 307..327 CDD:275368 6/20 (30%)
zf-H2C2_2 319..344 CDD:338759 10/25 (40%)
C2H2 Zn finger 335..355 CDD:275368 7/21 (33%)
C2H2 Zn finger 363..383 CDD:275368 8/20 (40%)
zf-H2C2_2 375..400 CDD:338759 8/25 (32%)
C2H2 Zn finger 391..407 CDD:275368 5/16 (31%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 29/137 (21%)
RRF <161..222 CDD:294170 12/62 (19%)
zf-C2H2_8 454..530 CDD:292531 20/76 (26%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 9/25 (36%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.