DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VIM and LamC

Sequence 1:NP_003371.2 Gene:VIM HGNCID:12692 Length:466 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster

Alignment Length:472 Identity:139/473 (29%)
Similarity:224/473 (47%) Gaps:91/473 (19%)


Human    31 VTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTE 95
            ||.:||           .||:..::..||  |:.||.|...|.....|                 
  Fly     6 VTLNTR-----------VSRASTSTPVGG--ASTSSRVGATSPTSPTR----------------- 40

Human    96 FKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAEL---EQLKGQGKSRLGDLYEEEMREL 157
              .:|..||.|||.||||.|.|||::|.||.:|..|..||   :....:..|.|..:||:|:...
  Fly    41 --TSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAA 103

Human   158 RRQVDQLTNDKARVEV-------ERDNL-------------AEDIMRL----------------- 185
            |:.:|:...:||::|:       |.|:|             ||:..||                 
  Fly   104 RKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLA 168

Human   186 -REKLQEE----MLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQEL 245
             |:|.:::    .|:.|.....|...|:.::..:|||:|||.:.:||:||:||..::|.:|:.|.
  Fly   169 DRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTET 233

Human   246 QAQIQEQHVQIDVDVSK---PDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNND 307
            :::.|.:..:||..:|:   ..|..:|:::|.|||.....|.:|.|..|.::..:|..||||...
  Fly   234 RSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQ 298

Human   308 ALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNM 372
            ....|.:|....|.::..|..::..|:.||..|..::||:|.....|...:...|..|:.|:|.|
  Fly   299 GSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRM 363

Human   373 KEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTH 437
            ::|||..|:|||.|:::|::||:|||.|.|||.|||.|:::..|.      |.|....:....:|
  Fly   364 RDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPG------RPTTDSGISSNGSH 422

Human   438 SKRTLLIKTVETRDGQV 454
                 |..:..:|.|:|
  Fly   423 -----LTASASSRSGRV 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VIMNP_003371.2 Head 2..95 14/64 (22%)
Filament_head 14..101 CDD:309741 15/70 (21%)
Coil 1A 96..131 18/35 (51%)
Filament 102..410 CDD:306535 115/356 (32%)
Linker 1 132..153 6/24 (25%)
Coil 1B 154..245 33/133 (25%)
Linker 12 246..268 5/25 (20%)
Coil 2 269..407 50/138 (36%)
[IL]-x-C-x-x-[DE] motif. {ECO:0000305|PubMed:25417112} 326..329 1/3 (33%)
Tail 408..466 10/48 (21%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 115/356 (32%)
ATP-synt_B <67..>142 CDD:304375 19/75 (25%)
MreC <178..>224 CDD:302802 16/46 (35%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.