DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VARS and GstE12

Sequence 1:XP_005249419.1 Gene:VARS HGNCID:12651 Length:1265 Species:Homo sapiens
Sequence 2:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster

Alignment Length:192 Identity:45/193 (23%)
Similarity:67/193 (35%) Gaps:66/193 (34%)


Human   560 LKGKNVIHPFL----SRSLPIVFDEFVDMDFGTGAVKITPAH-------------DQNDY--EVG 605
            |||:::...||    ..::|.:.|         |...|..:|             :|..|  |:.
  Fly    37 LKGEHLTPEFLKLNPQHTIPTLID---------GEATIIDSHAICAYLVEKYGQKEQQLYPKELV 92

Human   606 QRHGLEAISIMDSRGALINVPPPFLGLPRFEARKAVLVALKERGLFRGIEDNPMVVPLCNRSK-- 668
            ||..::|...:|| |.|.                |.|..|.|..|:.|..|       |:..|  
  Fly    93 QRANVDARLHLDS-GHLF----------------ARLRFLYEPILYYGSTD-------CSIDKIA 133

Human   669 ------DVVEPLLRPQWYVRCGEMAQAAS----AAVTR-GDLRILPEAHQRTWHAWMDNIRE 719
                  :::|..|:.|.|: ||.....|.    |.||. .|...:.|......|||:..:.|
  Fly   134 YIQKCWEILEGFLKDQPYL-CGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAE 194

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VARSXP_005249419.1 GstA <56..203 CDD:223698
GST_C_ValRS_N 92..213 CDD:198327
PTZ00419 283..1265 CDD:240411 45/193 (23%)
ValRS_core 336..939 CDD:185677 45/193 (23%)
tRNA-synt_1_2 514..>610 CDD:290334 15/69 (22%)
Anticodon_Ia_Val 939..1076 CDD:153416
Val_tRNA-synt_C 1197..1259 CDD:287436
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 10/49 (20%)
GstA 6..201 CDD:223698 45/193 (23%)
GST_C_Delta_Epsilon 92..210 CDD:198287 32/129 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.