DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VARS and GstT4

Sequence 1:XP_005249419.1 Gene:VARS HGNCID:12651 Length:1265 Species:Homo sapiens
Sequence 2:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster

Alignment Length:221 Identity:55/222 (25%)
Similarity:86/222 (39%) Gaps:43/222 (19%)


Human   342 IPPPNVTGSLHLGHALTNAIQDSLTRWHRMRGETTLWNPGCDHA-GIATQVVVEKKLWREQGLSR 405
            ||...:..|:..|..||...:|::.|:.::...|       ||. .::..|.:.:.|.||:.:..
  Fly    28 IPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAIT-------DHGYQLSENVAIFRHLAREKLVPE 85

Human   406 H-----QLGREAFLQEVWKWKEEK---GDRIYHQLKKLGSSLDWDRACFTMDPKLSAAVTEAFVR 462
            |     .|||.. :.|...|::..   ....|.|.|.|...|...|..   |..::.|..:....
  Fly    86 HWYPRRHLGRSR-IDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPA---DNAVNLASKQLEHT 146

Human   463 LHE-EGIIYRSTRLV---NWSCTLNSAISDIEVDK----KELTGRTLLS----------VPGYKE 509
            |:| |.:...|.:.:   |.|....|||.:|:..|    .....|..|:          .|.|||
  Fly   147 LNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLARWYETVREELGPHYKE 211

Human   510 KVEFGVLVSFAYKVQGSDSDEEVVVA 535
                 ||..|..|::||.|.::..||
  Fly   212 -----VLGEFEAKLKGSGSGQQQGVA 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VARSXP_005249419.1 GstA <56..203 CDD:223698
GST_C_ValRS_N 92..213 CDD:198327
PTZ00419 283..1265 CDD:240411 55/222 (25%)
ValRS_core 336..939 CDD:185677 55/222 (25%)
tRNA-synt_1_2 514..>610 CDD:290334 9/23 (39%)
Anticodon_Ia_Val 939..1076 CDD:153416
Val_tRNA-synt_C 1197..1259 CDD:287436
GstT4NP_572886.2 GstA 5..203 CDD:223698 42/186 (23%)
GST_N_Theta 5..80 CDD:239348 14/59 (24%)
GST_C_Theta 95..220 CDD:198292 32/134 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.