DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: USH2A and tutl

Sequence 1:NP_996816.2 Gene:USH2A HGNCID:12601 Length:5202 Species:Homo sapiens
Sequence 2:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster

Alignment Length:1780 Identity:337/1781 (19%)
Similarity:536/1781 (30%) Gaps:599/1781 (34%)


Human  3337 CSASSGE-----SKAHIKKNDPVPV------KC------CETELIPKSQKCCNGVGYNPLKYVCS 3384
            |.|.|.:     ||...:::.|:.:      ||      ..|..||.|:.    :..:|.|    
  Fly    13 CRALSTQHNTEKSKEQQQQSQPLEIPEQRASKCRGDIDRTTTTTIPASKT----LTASPAK---- 69

Human  3385 DKISTGMMMKETKECRILCPASMEATEHCGRCDFNFTSHICTVIRGSHNSTGKASIEEMCSSAEE 3449
               :....:|.|:..|     |....|         .|.||..||....||...:|        :
  Fly    70 ---TAAFTVKTTRRRR-----SRRRAE---------GSSICVPIRRGQGSTPTPTI--------Q 109

Human  3450 TIHTGSVNTYSYTDVNLKPYMTYEYRISAWNSYGRGLSKAVRARTKEDVPQGVSPPTWTKIDNLE 3514
            .:....|:..:....|.:.:...|..:......|.|:..........|.|.              
  Fly   110 VLQFVLVSLLALLAKNAQAHNIPEDAVHITAILGEGVIFNCHVEFPNDHPV-------------- 160

Human  3515 DTIVLNWRKPIQSNG---PI-IYYILLRNGIER--------------FRGTSLSFSD-KEGIQPF 3560
             ..||.|.|.:...|   || |:|......||.              |...||:.:: :|..|.:
  Fly   161 -PYVLQWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGW 224

Human  3561 QEYSYQLKACTVAGCATSSKVVAATTQGVPESILPP--SITALSAVALHLSWSV----------- 3612
            .|       |.|.......|.....|....:...||  |:|....:.::|..|:           
  Fly   225 YE-------CKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTPT 282

Human  3613 PE-----KSNGVIKEYQIRQVGKGLIHTDTTDRRQHTV--TGLQPYT--------NYSFTLTACT 3662
            ||     .:|.|...   ..||   |..|.|:.|..|:  ..:..||        ..|.|.....
  Fly   283 PEILWYKDANPVDPS---PTVG---IFNDGTELRISTIRHEDIGEYTCIARNGEGQVSHTARVII 341

Human  3663 SAGCTSSEPFLGQTLQAAPEGVWVTPRHIIINSTTVELY--WSLPEKPNGLVSQYQLSRNGNLLF 3725
            :.|.....|...||.....:.::......:..:.||..|  .|...:...|.::..:.::|:|:.
  Fly   342 AGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLII 406

Human  3726 LGGSEEQNFTDKNLEPNSRYTYKLEVKTGGG--SSASDDYIVQTPMS---TPEEIYPPYNITVI- 3784
                       ..::|:....|..||..|.|  .|||....|:.|..   ||...|.|:.:..: 
  Fly   407 -----------NPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVV 460

Human  3785 ------GPYSIFVAWIPPGILIPEIPVEYNVLLNDGSVTPLAFSVGHHQSTLLENLTPFTQYEIR 3843
                  .|...:|.|.....|:....::..|::.:||   |.|:..:.:.......||:.     
  Fly   461 QCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGS---LLFTRVNEEHQGQYACTPYN----- 517

Human  3844 IQACQNGSCGVSSRM---------FVKTPEAA-------PMDLNSPVLKALGSACIEIKWMPPEK 3892
                ..|:.|.|..|         |...||..       .::::...|:|.|:....|||..   
  Fly   518 ----AQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGTERPTIKWQR--- 575

Human  3893 PNGIIINYFIYRRPAGIEEESVLFVWSEGALEFMDEGDTLRPFTLYEYRVRACNSKGSVESLWSL 3957
                             :|...|.......::......|:......::....|.....|.:|.::
  Fly   576 -----------------QEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNEVATLMAV 623

Human  3958 TQTLEAPPQDFPAPW---AQATSAHSVLLNWTKPESPNGIISHYRVVYQERPDDPTFNSPTVHAF 4019
            ||.:....|.. ||:   .:||.: |:.|.|. |....|  |.|:..|.....:...|.....:.
  Fly   624 TQLVIEGTQPH-APYNITGKATES-SITLQWL-PGYSGG--SEYKQDYTIWFREAGVNDWQTISV 683

Human  4020 TVKGTSHQAHLYGLEPFTTYRIGVVAANHAGE-ILSPWTLIQTLESSPSGLRNFIVEQKENGRAL 4083
            |..| |.|..:.||...|||...||..|..|: ::|....::|||.:|:..||            
  Fly   684 TPSG-STQVTINGLASGTTYEFQVVGRNVLGDGMMSKVMTVRTLEDAPAAPRN------------ 735

Human  4084 LLQWSEPMRTNGVIKTYNIFSDGFLEYSGLNRQFLFRRLDPFTLYTLTLEACTRAGCAHS----- 4143
                         :|......|.|.       |.:....|....:.:.....:|....:|     
  Fly   736 -------------VKAATQPPDSFF-------QLMPDEADLLAYFDIYFHTDSRGTLVYSPPKLR 780

Human  4144 --APQPLWTDEAPPDSQLAPTVHSVKSTSVE----LSWSEPVNPNGKIIRYEVIRRCFEGKAWGN 4202
              .|:|     .||        .:|..|.|.    ::|..|:. ...|:::..|:          
  Fly   781 VKGPKP-----GPP--------RNVSVTEVSNGFLITWQSPLE-RAHIVKFYTIK---------- 821

Human  4203 QTIQADEKIVFTEYNTERNTFMYNDTGLQPWTQCEYKIYTWNSAGHTCSSWNVVRTLQAPPEGLS 4267
                         |.|:......|...::| .:.:|.:.  |..|.....:.|:...:.      
  Fly   822 -------------YRTDAQWKTLNRGQIRP-EETQYLVK--NLVGGRTYYFRVLANSEK------ 864

Human  4268 PPVISYVSMN------PQKLLISWIPPEQSNGII------------------QSYRLQRNEMLYP 4308
                ||.|.:      |.::....|......||:                  :..|.|..|    
  Fly   865 ----SYESSDEVKFPVPARVKHKAITAGVVGGILFFIVAIILSVCAVKICNKRKRRKQEKE---- 921

Human  4309 FSFDPVTFNYTDEELLPFSTYSYALQACTSGGCSTS-------KPTSITTLEAAPSEVS----PP 4362
              |:.|....||...:  :..::.|...::|..|:.       |.|.|::|.|....:.    ||
  Fly   922 --FNMVACRITDARNI--AANNHHLHNRSTGSISSGQVPLKKYKQTRISSLTAILIAILHWIWPP 982

Human  4363 DLWAVSATQMNVCWSPPTVQNGKITKYLVRYDNKESLAGQGLCLLVSHLQPYSQYNFSLVACTNG 4427
            |    ..|..:..:|.|.:::|           .|...|.|....||.:|......|.|      
  Fly   983 D----RCTNCHSIYSSPNLEDG-----------DEDDGGGGRRRSVSRIQRSLDGRFVL------ 1026

Human  4428 GCTASVSKSAWTMEALPENMDSPTLQVTGSESIEITWKPPRNPNGQIRSYELRRDGTIVYTGLET 4492
             ....|||..::.:.|    :|..:.|......|     .||.|...:|..  .||     |..:
  Fly  1027 -DVEGVSKLGYSQQTL----ESGNVDVVDGGLFE-----RRNSNVSQKSSS--DDG-----GFLS 1074

Human  4493 RYRDFTLTPGVEYSYTVTASNSQ----------GGILSPLVKDRTSPSAPSGMEPPKLQARGPQE 4547
            | |:| :|....:...:.||:||          .|.|..|:|.....||    .||..|:...:.
  Fly  1075 R-RNF-ITARASWRRPLVASSSQLSLQSAADSARGFLQGLLKIGAKQSA----VPPNSQSYFDEA 1133

Human  4548 ILVNWDPPVRTNGDIINYTLFIRELFERETKIIHINTTHNSFGMQSYIVNQLKPFHRYEIRIQAC 4612
            :     ...|....:..||                 :::|.:|.    .::.:|.|        .
  Fly  1134 V-----SGARYQNVLRPYT-----------------SSNNLYGN----ADRSRPLH--------I 1164

Human  4613 TTLGCASSDWTFIQTP-EIAPLMQPPPHLEVQMAPGGFQPTVSLLWTGPLQPNGKVLYYELYRRQ 4676
            .|:..:.|....:.|| .|:.:....|.                    .|||:.:.|        
  Fly  1165 NTISGSLSQQQQLYTPSRISRIFSSSPQ--------------------QLQPHHQQL-------- 1201

Human  4677 IATQPRKSNPVLIYNGSS----TSFIDSELLPFTEYEYQVWAVNSAGKAPSSWTWCRTGPAPPEG 4737
                       |:.:|.|    |.|.|..    |.|                         ||. 
  Fly  1202 -----------LLSSGGSGAYPTHFSDLS----TVY-------------------------PPN- 1225

Human  4738 LRAPTFHVISSTQAVVNISAPGKPNGIVSLYRLFSSSAHGAETVLSE-GMATQQTLHGLQAFTNY 4801
                              ||....:.:.|.||.:|.......|:..| ....||..|.|:   ::
  Fly  1226 ------------------SAERSSHNLSSRYRYYSQELPSLRTIQEETRRQQQQKQHPLE---DH 1269

Human  4802 SIGVEACTCFNCCSKGPTAELRTHPAPPSGLSSPQIGTLASRTASFRWSP----PMFPNGVIHSY 4862
            .:.::.                  |:|||..|..|  :.||.....||.|    .:|.|      
  Fly  1270 FVPLQL------------------PSPPSWRSYYQ--SQASYRPRTRWYPRHHSRLFSN------ 1308

Human  4863 ELQFHVACPPDSALP---------CTPSQIE------TKYTGLGQKASLGGLQPYTTYKLRVVAH 4912
            ..|.|....|   ||         ..|..:|      :..:|.|.|.:                .
  Fly  1309 RQQQHEMLSP---LPQLNLNLRNSMNPGGLEASPESRSSSSGFGSKNT----------------S 1354

Human  4913 NEVGSTASEWISFTTQKELPQYRAP 4937
            |..||| |||      :.||.||||
  Fly  1355 NHPGST-SEW------RLLPPYRAP 1372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
USH2ANP_996816.2 LamGL 146..283 CDD:214722
Laminin_N 295..516 CDD:295486
EGF_Lam 517..565 CDD:238012
EGF_Lam 574..639 CDD:238012
Laminin_EGF 641..691 CDD:278482
EGF_Lam 694..733 CDD:214543
Laminin_EGF 747..795 CDD:278482
EGF_Lam 794..844 CDD:238012
EGF_Lam 847..897 CDD:214543
EGF_Lam 900..948 CDD:238012
EGF_Lam 950..1000 CDD:238012
EGF_Lam 1001..>1037 CDD:238012
FN3 1060..1143 CDD:238020
FN3 1145..1238 CDD:238020
FN3 1242..1357 CDD:238020
FN3 1368..1451 CDD:214495
LamG 1519..1678 CDD:238058
LamG 1716..1868 CDD:238058
fn3 1956..2044 CDD:278470
FN3 2241..2313 CDD:238020
FN3 2329..2428 CDD:238020
FN3 2432..2528 CDD:238020
FN3 2533..2619 CDD:238020
FN3 2621..2719 CDD:238020
FN3 2724..2799 CDD:238020
FN3 2818..2920 CDD:238020
FN3 2925..3015 CDD:238020
FN3 3026..>3087 CDD:238020
FN3 <3449..3494 CDD:238020 5/45 (11%)
FN3 3503..3586 CDD:238020 20/102 (20%)
FN3 3590..3676 CDD:238020 24/114 (21%)
FN3 3680..3767 CDD:238020 17/91 (19%)
fn3 3777..3856 CDD:278470 15/86 (17%)
FN3 3866..3960 CDD:238020 14/101 (14%)
FN3 3964..4057 CDD:238020 28/97 (29%)
FN3 4161..4247 CDD:238020 13/90 (14%)
FN3 4268..4351 CDD:238020 20/114 (18%)
FN3 4356..4439 CDD:238020 18/87 (21%)
FN3 4444..4516 CDD:238020 18/82 (22%)
FN3 4529..4627 CDD:238020 14/98 (14%)
FN3 4636..4730 CDD:238020 13/98 (13%)
FN3 4826..4927 CDD:238020 30/120 (25%)
PDZ-binding 5200..5202
tutlNP_001303307.1 V-set 137..250 CDD:284989 25/135 (19%)
IG_like 137..229 CDD:214653 22/114 (19%)
I-set 253..341 CDD:254352 20/94 (21%)
IGc2 268..331 CDD:197706 14/69 (20%)
I-set 346..437 CDD:254352 19/102 (19%)
Ig 349..437 CDD:299845 19/99 (19%)
Ig 459..530 CDD:299845 15/83 (18%)
IG_like 549..628 CDD:214653 14/99 (14%)
IGc2 551..617 CDD:197706 10/86 (12%)
FN3 633..725 CDD:238020 27/98 (28%)
FN3 786..874 CDD:238020 21/138 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.