DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42402 and eva1ab

DIOPT Version :10

Sequence 1:NP_001287642.1 Gene:CG42402 / 7354470 FlyBaseID:FBgn0259821 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001070055.2 Gene:eva1ab / 767647 ZFINID:ZDB-GENE-060929-200 Length:153 Species:Danio rerio


Alignment Length:134 Identity:31/134 - (23%)
Similarity:58/134 - (43%) Gaps:18/134 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 LEEDQERLYFYLLALVSLGVLISIVIFGTRIALQKHHLVTETLSSSFAKTTRRVEETTIPSGLND 524
            :.:..||...|.:..|.||::::::....:|:.:     |:..:....|.|.:..|.|     :|
Zfish    29 IADQPERAALYFVCGVCLGLVLTLIALVVQISCR-----TDCKTQQAPKKTGKTVENT-----SD 83

  Fly   525 TISEIDAEIDLKTTLPLPNLSNKENYLTYAPTSSLYADLPRNQLVSACSQGSAAGQI---GKPHI 586
            | |:.|::.|..:.|........|..|....||:  .:|.|.|.:.  .:.....:|   |:|.:
Zfish    84 T-SDSDSDWDNTSDLSARRHRRFERTLGNVFTSA--EELERAQRLE--ERERIIREIWMNGQPDM 143

  Fly   587 VGTR 590
            .|||
Zfish   144 PGTR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42402NP_001287642.1 Gal_Rha_Lectin 51..261 CDD:459238
Gal_Rha_Lectin_EVA1_EVA1C_rpt2 264..361 CDD:438686
eva1abNP_001070055.2 FAM176 15..153 CDD:464347 31/134 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..97 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.