DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42402 and si:dkey-240e12.6

DIOPT Version :10

Sequence 1:NP_001287642.1 Gene:CG42402 / 7354470 FlyBaseID:FBgn0259821 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001082844.1 Gene:si:dkey-240e12.6 / 557168 ZFINID:ZDB-GENE-050208-367 Length:137 Species:Danio rerio


Alignment Length:95 Identity:31/95 - (32%)
Similarity:47/95 - (49%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 SKVACHNDVAQLECNPYSRIAVYSASFGRTEYESIQCP-QPQGVREETCLASYATETVMQICHGR 329
            |..||...|.:|.|..:::|.:.:|::|||:.::.... .|:.||...|.:|.:...|...|.||
Zfish    39 SVTACEGSVLRLSCPGHTKIKILAANYGRTDKKTCNINLSPRQVRNTNCRSSNSLPRVSARCDGR 103

  Fly   330 RRCNLAADANTFGSPCQPNSRMYLKVVYTC 359
            ..|.:.|....|..|| |.:..||.|.|.|
Zfish   104 ESCYVPATNGVFSDPC-PRTYKYLTVKYCC 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42402NP_001287642.1 Gal_Rha_Lectin 51..261 CDD:459238
Gal_Rha_Lectin_EVA1_EVA1C_rpt2 264..361 CDD:438686 31/95 (33%)
si:dkey-240e12.6NP_001082844.1 Gal_Rha_Lectin_SUL-I-like 40..132 CDD:438684 29/92 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.