DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42395 and AdenoK

DIOPT Version :8

Sequence 1:NP_001138182.3 Gene:CG42395 / 7354436 FlyBaseID:FBgn0259741 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001287054.1 Gene:AdenoK / 39479 FlyBaseID:FBgn0036337 Length:345 Species:Drosophila melanogaster

Alignment Length:155 Identity:32/155 - (20%)
Similarity:57/155 - (36%) Gaps:39/155 - (25%)


  Fly     1 MAETLHYLIL---RNPSSQIVIASANAVLESIGLENWKIPVDDSIVSLP---PSAQSYVHSHSSL 59
            |..||...||   .||     :...:||:....|:.:.:..||:|::..   |.....|..:.:.
  Fly     1 MTSTLQEGILVGCGNP-----LLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAE 60

  Fly    60 YCLAGCHYHFMRLAGIGGASAIFMSAYCKYVLRD--IESIREQLDSQAFADVANRIHFLHSFALM 122
            :...|...:.:|:|              :::||.  :......:....:|::      |...|..
  Fly    61 FLAGGSVQNSLRIA--------------QWILRQPRVAVFFGCVGEDRYANI------LKEKAQA 105

  Fly   123 AMPLAHY------PFLTGTLMITGT 141
            |....||      |..|..::||||
  Fly   106 AGLDVHYQVKKDVPTGTCAVLITGT 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42395NP_001138182.3 DUF423 83..168 CDD:282144 14/67 (21%)
AdenoKNP_001287054.1 PTZ00247 10..343 CDD:240328 28/146 (19%)
ribokinase_pfkB_like 14..343 CDD:294126 27/142 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C118260566
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.