DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLc and Otop3

DIOPT Version :8

Sequence 1:NP_001303575.1 Gene:OtopLc / 7354434 FlyBaseID:FBgn0259150 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_081408.2 Gene:Otop3 / 69602 MGIID:1916852 Length:596 Species:Mus musculus

Alignment Length:688 Identity:152/689 (22%)
Similarity:255/689 (37%) Gaps:170/689 (25%)


  Fly   825 PDSSDPPSSPGGSSSQPALSGSQADGQLALMYHSHQLTNYPVLPAIK---RTHRPSFVYPPMPRV 886
            |....|..||...:::.|.|..|||     |...|  ...|..|..|   ..|....:.......
Mouse     8 PAEPAPMPSPEAKTTEGASSYDQAD-----METKH--AGSPCPPKQKSWLARHFSLLLRRDRQAQ 65

  Fly   887 KAGDALATLFSALYGKLLVVMGIAFPMAEVISTYIPPSFYEVYYLYLYIGSMIFLLFMYATLIWG 951
            |||.    |||.|....:|.:|.|| :..:|...:..:..:|:.|...:..:..|..:|.|:   
Mouse    66 KAGQ----LFSGLLALNVVFLGGAF-ICSMIFNKVSVTLGDVWILLAALKVLSLLWLLYYTV--- 122

  Fly   952 RPKLPVPIASPSKSATKASGTDSMDESDTDSNSVHHRLPPPIPVRRPSLLSPLGRRDAHYGSFYL 1016
                               ||                      .|:|..:.   .||.|.|..::
Mouse   123 -------------------GT----------------------TRKPHAVL---YRDPHAGPIWV 143

  Fly  1017 RMGAVAFGIGSMIYSGLEFGQYFELNPDTK---CHNVLLALTPATRMAFIFIQMYFIFLN-NEQI 1077
            |...|.||..::..:      .|.:..|..   |.:.:..:.||..:.|:.||.:.::.: .:.:
Mouse   144 RGSLVLFGSCTVCLN------IFRMGYDVSHIHCKSEVELIFPAIEIVFMIIQTWVLWRHCKDCV 202

  Fly  1078 KVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQH 1142
            :|...  ..|.|||..:.|||.:|:..:..::.|.            .|...:.......:::|.
Mouse   203 QVQTN--FTRCGLMLTLATNLLMWVLAVTNDSMHR------------EIEAELDALMEKFSVLQC 253

  Fly  1143 DPTAH--LRVPRGLKG-PYQIFECRRTNII-----GTLVQDASPFLFPCTIEYSLICAAILYVMW 1199
            .....  |.:|..|.| ......|..|.:.     |.|:      |:|.:.||.|||.|:|:|||
Mouse   254 RTCLRCCLFLPYLLSGNGTNTCMCLNTTVCEVFRKGYLM------LYPFSTEYCLICCAVLFVMW 312

  Fly  1200 RSISRP-QTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLF---VGILILVLTIISLIIFFVLIS 1260
            :::||. ...|...|:       |||.       |.|..:|   :|:|.||..:...::|.:..|
Mouse   313 KNVSRSLAAHTGAHPN-------RSPF-------RLHGTIFGPLLGLLALVAGVCVFVLFQIEAS 363

  Fly  1261 RPEFVAMAVTEVTICELLIYGTATIATLVGM----IQIRHLQYDAYRSFSLDDILLVGAQTGSFL 1321
            .|:......|......:.:..|.::|.|.|.    ::.|.|......:.|||.:||:||..|...
Mouse   364 GPDIARQYFTLYYAFYVAVLPTMSLACLAGTAIHGLEERELDTLKNPTRSLDVVLLMGAALGQMG 428

  Fly  1322 YNIFTVIA-----GHFTLRSDDMLVPINALASIVQTACQTMFILD-------------------- 1361
            ...|:::|     .|..|   :.|:...:|..|:|...|.:||::                    
Mouse   429 IAYFSIVAIVATQPHELL---NQLILAYSLLLILQHITQNLFIIEGLHRRPLWEPAVSGVMEKQD 490

  Fly  1362 ------------------ASRRQAVSPEHL--RKKPGREIVTFMLVVNLAMWAISTLEKSRAESH 1406
                              |||....|..||  :::..:||..|:::.|:.:|.:..........:
Mouse   491 VELPRRGSLRELGQDLRRASRAYIHSFSHLNWKRRMLKEISLFLILCNITLWMMPAFGIHPEFEN 555

  Fly  1407 PIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIW 1444
            .::.:|||...|..|.:..:||.:|||.||...|.|::
Mouse   556 GLEKDFYGYRTWFTIVNFGLPLGVFYRMHSVGGLVEVY 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OtopLcNP_001303575.1 Otopetrin 1015..1434 CDD:281218 108/484 (22%)
Otop3NP_081408.2 Otopetrin 143..582 CDD:281218 107/482 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4740
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130839
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21522
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.870

Return to query results.
Submit another query.