DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLc and otop2

DIOPT Version :8

Sequence 1:NP_001303575.1 Gene:OtopLc / 7354434 FlyBaseID:FBgn0259150 Length:1596 Species:Drosophila melanogaster
Sequence 2:XP_001338079.4 Gene:otop2 / 494472 ZFINID:ZDB-GENE-050104-2 Length:572 Species:Danio rerio

Alignment Length:700 Identity:146/700 (21%)
Similarity:253/700 (36%) Gaps:224/700 (32%)


  Fly   831 PSSPGGSSSQPALSGSQAD-----GQLA-LMYHSHQLTNYPVLPAIKRTHRPSFVYPPMPRVKAG 889
            |....||.|..:...::||     .|:: :...||..|             |:..:.|:.:.:..
Zfish     6 PQKASGSYSCSSNMSTKADLEAMENQISTIQISSHGET-------------PNRGFKPVEKGRNW 57

  Fly   890 DALATLFSALYGKLL---VVMGIAFPMAEVISTYIPPSFYEVYYLYLYIGSMIFLLF-------M 944
            ..|.:.|.:|...||   :|.|..|...::.|:::     .::.:.|.|.|.:::|:       :
Zfish    58 GWLLSGFISLNALLLGIAIVSGSVFNKVQITSSHL-----LIFLILLVILSTVWMLYYKVHTSRV 117

  Fly   945 YATLIWGRPKLPVPIASPSKSATKASGTDSMDESDTDSNSVHHRLPPPIPVRRPSLLSPLGRRDA 1009
            |..:::                                                        :|:
Zfish   118 YRAVLY--------------------------------------------------------KDS 126

  Fly  1010 HYGSFYLRMGAVAFGIGSMIYSGLEFGQYF-ELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLN 1073
            |.|..:||.|.|.|||.|:|....:...|. .:|    |.:.:....|..:..|:.:|.|.::::
Zfish   127 HAGPVWLRTGLVLFGICSVIMDIFKIIFYVGRMN----CESPVKIAFPVVQAVFVIVQTYVLWIH 187

  Fly  1074 NE---QIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSR 1135
            .:   |||    :.|.|.|||..:.|||.||:..:.:|:.|:.:....|                
Zfish   188 AKDCVQIK----QNITRCGLMLTLSTNLMVWMMAVTEESLHQTVAPVKP---------------- 232

  Fly  1136 GHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWR 1200
                    ||.:......|.|.....||...:.:..|.:.|..:|:|..|||||..:|:.||||:
Zfish   233 --------PTNNNSYNDTLDGRAAASECECLHNMCDLFEKAYYYLYPFNIEYSLFASAMTYVMWK 289

  Fly  1201 SISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHK----------GLFVGILILVLTIISLIIF 1255
            ::.|                |...||       :||          |...|:::||..:.:.:::
Zfish   290 NVGR----------------KMDDHH-------SHKLHFSLWDVLVGPLAGLIVLVAGLATFVVY 331

  Fly  1256 FVLIS------RPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAYRSFSLDDILLVG 1314
            .|.:|      :.|.:.|......:..||:..:|....::..:..|........:.|||..||||
Zfish   332 EVDVSKDDPKKKEEALIMHYIMNIVAVLLMSSSALAGCILFRMDKREQVSGKNPTRSLDVGLLVG 396

  Fly  1315 AQTGSFLYNIFTVIA-------GHFTLRSDDMLVPIN---ALASIVQTACQTMFIL--------- 1360
            |..|.||...||::|       ||..        .:|   |:.::::...|..|::         
Zfish   397 ASLGQFLICYFTIVAVLASGVQGHTN--------GLNLACAMLTVIELCIQNAFLIKGLHREPFK 453

  Fly  1361 -----------------DASRR-QAVSPEHLRKKP-----GR---------EIVTFMLVVNLAMW 1393
                             |..|| .::.|.|....|     ||         ||..|:|:.|:.:|
Zfish   454 ETEVATVFANVMAVKERDPERRSSSIVPAHTLPIPLTLLQGRMSWKRRVLKEICAFLLLCNVTLW 518

  Fly  1394 AISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEI 1443
            .|..........:.:..:.|....|..:.::.||..||||.||...|.|:
Zfish   519 IIPAFGARPQFDNTVGPDVYEFQTWAAVVNIGMPFGIFYRMHSVASLFEV 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OtopLcNP_001303575.1 Otopetrin 1015..1434 CDD:281218 113/490 (23%)
otop2XP_001338079.4 Otopetrin 133..558 CDD:281218 112/488 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4740
Hieranoid 1 1.000
Homologene 1 1.000 H27803
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128573
orthoMCL 1 0.900 OOG5_133902
Panther 1 1.100 O PTHR21522
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3542
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.