DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLc and OtopLb

DIOPT Version :8

Sequence 1:NP_001303575.1 Gene:OtopLc / 7354434 FlyBaseID:FBgn0259150 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_608758.1 Gene:OtopLb / 33539 FlyBaseID:FBgn0031514 Length:797 Species:Drosophila melanogaster

Alignment Length:845 Identity:303/846 (36%)
Similarity:429/846 (51%) Gaps:156/846 (18%)


  Fly   688 HHHYHLPHQFQHPHHQNHHTHSVRVPTPTVPSSYAPPPPPDSGSSSSPVDRRRLFMAGVAPPIA- 751
            |:|:.:..:....|..:.....:.:..|....|:: ..||.|..:|.|...|....|.....|. 
  Fly    26 HYHHDVISKGNDSHRSSDACEYITISAPKKSGSFS-RSPPSSLPTSVPGTPRHSVAATSNQVIRY 89

  Fly   752 -------AGAGSLMAMPAEPAVAISPGRVS---ARSGSQ------------HH----VTIDESSL 790
                   .|..|:..|...|...::..:.:   ...|||            ||    .|:..|..
  Fly    90 ARTSCDHCGHHSIPVMSPHPISPLAKSQTNLDLVEHGSQRQALLPLPTVGMHHEDSACTLQVSRR 154

  Fly   791 PSHKGNIQETPGPSGLIIGGGDGDG---DRDIGGGG--GPDSSDPPSSPGGSSSQPALSGSQA-- 848
            ||..  :||.......:.|..||:|   .|....|.  |..|....:....|.:..|.:||.|  
  Fly   155 PSLL--LQEILTQRPPLFGRRDGNGFLSPRTAKNGNLQGTASGSTATINFQSGATSARNGSTAFF 217

  Fly   849 -DGQLALMYHSHQLTNYPVLPAIKRTHRPSFVYPPMPRVKAGDALATLFSALYGKLLVVMGIAFP 912
             :|..:......:..|       :||              ..||:::..||.|.||||::|:..|
  Fly   218 DNGAKSFQAKQQKDKN-------RRT--------------GNDAISSALSATYCKLLVLLGVCLP 261

  Fly   913 MAEVISTYIPPSFYEVYYLYLYIGSMIFLLFMYATLIWGRPKLPVPIASPSKSATKASGTDSMDE 977
            :.||||..||...|:.:|:|||:||::|::|:|.:....|...         :|.|       |.
  Fly   262 ITEVISDQIPTYVYQGFYVYLYVGSILFVIFLYISAFRNRSLF---------NALK-------DY 310

  Fly   978 SDTDSNSVHHRLPPPIPVRRPSLLSPLGRRDAHYGSFYLRMGAVAFGIGSMIYSGLEFGQYFELN 1042
            .:.:|| ||                 |..:..|:||||||:||:||.||:|:||||||||:||||
  Fly   311 HEKNSN-VH-----------------LKHKVTHFGSFYLRVGAIAFAIGTMVYSGLEFGQFFELN 357

  Fly  1043 PDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQ 1107
            ....|.:|.:|:||..||.....|:.|||||...:.:.|:|:.:|||||||:.|||..||.||::
  Fly   358 GHPGCRDVFVAITPICRMVLCIAQVQFIFLNTTYMDMARHKVTSRFGLMHMVATNLCEWLYVLVE 422

  Fly  1108 ETKHEI-------------LTFYNPE-NRT--LRISHRIPGHSRGHAI----------------I 1140
            ||||||             |..:|.. :||  ..::..:..|...||:                |
  Fly   423 ETKHEIFHISQHEVDPAHDLVIHNSSMSRTDWAAVNESLHQHHHHHALNNTLVANVSSVIVNMTI 487

  Fly  1141 QHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRP 1205
            ...||     |....|      |.||.|:|.|||..||||||||||||||||.||:.||:::...
  Fly   488 TPSPT-----PAAFSG------CSRTTIMGALVQQLSPFLFPCTIEYSLICAVILFEMWKTVKSI 541

  Fly  1206 QTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVT 1270
            ......|.:.:.....:..||:||||:::|||||.||||:|:||||:|::|||.::|.:..:|..
  Fly   542 PDIDKTRKNSVKPAAAKPAHHFSVDCSQSHKGLFFGILIIVMTIISMIMYFVLYTQPGYELVATQ 606

  Fly  1271 EVTICELLIYGTATIATLVGMIQIRHLQY-----DAYRSFSLDDILLVGAQTGSFLYNIFTVIAG 1330
            |||:.|..:|.....|.:.|||.:|.|:|     |.:.|..||::||:.||||.:||.:|:::..
  Fly   607 EVTLWETFMYFMCAAAVITGMILMRDLRYIKNTSDEHHSMDLDNLLLIVAQTGVYLYGMFSILGS 671

  Fly  1331 HFTLRSDDMLVP------INALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVN 1389
            :|. :.|  .||      |..:..:|||:.||||||.:|.|:......:|:||||||:||:||.|
  Fly   672 YFA-KWD--TVPDRVEGIIAEVFGVVQTSLQTMFILHSSHRRCRGTNQVRRKPGREIITFLLVAN 733

  Fly  1390 LAMWAISTLEKSRA---ESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYKLK 1451
            :|:|.::||.|.||   |||   |.|:|:|.||||||:|||||||||||||:||.|:||..||.|
  Fly   734 IAIWFVNTLIKGRAVFRESH---LEFFGVWGWTIITHISMPLAIFYRFHSTICLFEVWKITYKAK 795

  Fly  1452  1451
              Fly   796  795

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OtopLcNP_001303575.1 Otopetrin 1015..1434 CDD:281218 206/465 (44%)
OtopLbNP_608758.1 Otopetrin 330..778 CDD:281218 206/465 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4740
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002924
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21522
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.