DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLc and otpl-3

DIOPT Version :8

Sequence 1:NP_001303575.1 Gene:OtopLc / 7354434 FlyBaseID:FBgn0259150 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_509170.1 Gene:otpl-3 / 259710 WormBaseID:WBGene00017449 Length:566 Species:Caenorhabditis elegans

Alignment Length:592 Identity:152/593 (26%)
Similarity:262/593 (44%) Gaps:128/593 (22%)


  Fly   895 LFSALYGKLLVVMGIAFPMAEVISTYIPPSFYEVYYL----YLYIGSMIFLLF-------MYATL 948
            ||:..|...:|:.||...::.:|:.........:..|    :|..||::|:.:       |:.|:
 Worm    51 LFTCFYAIFIVIAGIVIELSNIIAAEENTGKISIKDLVLGTWLLGGSILFIAYCSYLVHDMHFTI 115

  Fly   949 IWGRPKLPVPIASPSKSATKASGTDSMDESDTDSNSVHHRLPPPIPVRRPSLLSPLGRRDAHYGS 1013
                .:..:.:.:...|||:                             |.:|:     :...||
 Worm   116 ----KRQRISLRNSGISATE-----------------------------PEVLA-----NTSTGS 142

  Fly  1014 FYLRMGAVAFGIGSMIYSGLEF--------GQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFI 1070
            .|||:|.|.|||..::|..|.|        ....|.:..:...||:.|:       |||:||:|:
 Worm   143 LYLRLGCVVFGIIGVVYYLLIFVICLLGWSSNEGECSVISDVLNVMAAV-------FIFVQMWFV 200

  Fly  1071 FLNNEQIKVYRYKII-------ARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISH 1128
            :.|.        |||       |||||||:.||||.:||..::.|....:....:.::..|    
 Worm   201 YCNG--------KIIFTGDGNLARFGLMHLTGTNLWMWLRYILYEEVETVKEIRHVQHANL---- 253

  Fly  1129 RIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAA 1193
                 |:..|   |....|   ....||...||            ...:.|::.|.:|||||||.
 Worm   254 -----SKASA---HHHEVH---EEACKGVLCIF------------NGYNEFMYTCVVEYSLICAG 295

  Fly  1194 ILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVL 1258
            :.:|.|.::.|     .:|..|.....|||  ...:||:|..:|||.|...:::|||::.:|.. 
 Worm   296 VAFVFWANLER-----LKREQMEKKMKKRS--ILKIDCSRTAEGLFAGFACIIVTIIAIALFNA- 352

  Fly  1259 ISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQY-------DAYRSFSLDDILLVGAQ 1316
            .|..:.||..:...|  .:..:..:|...:....::|:|::       :...:..||.||||...
 Worm   353 YSSDKNVAQWIFSCT--NMSFFLVSTFLVVFAFWRMRYLKFLMEDDDEEDDNAELLDRILLVVGL 415

  Fly  1317 TGSFLYNIFTVIA--GHFTLRSDDMLVPINALASIVQTACQTMFILDASR-RQAVSPEH-LRKKP 1377
            .|..:::|..:::  .:.|:....::...|.| .::|...|:..::.||| |...|.:| ||.||
 Worm   416 IGELIFSIGGILSFINNMTIGLPLIIFTTNVL-RLIQVTFQSCLLMVASRLRIEESNQHMLRYKP 479

  Fly  1378 GREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCE 1442
            |::::|.:|::|.|.:.::..|..:|..:...::.||.:.|.|:.....||.|||||||:.|..|
 Worm   480 GKQVITMLLMMNCAQFMMNVFEAQKAGINDEMIHMYGSYYWAIVVRGCSPLTIFYRFHSSACFAE 544

  Fly  1443 IWKRAYK 1449
            |||:.::
 Worm   545 IWKKTFR 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OtopLcNP_001303575.1 Otopetrin 1015..1434 CDD:281218 123/445 (28%)
otpl-3NP_509170.1 Otopetrin 144..536 CDD:281218 123/445 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4740
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002924
OrthoInspector 1 1.000 T97951
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21522
Phylome 1 0.910 0.778 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3542
TreeFam 1 0.960
87.900

Return to query results.
Submit another query.