DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLc and Otop2

DIOPT Version :8

Sequence 1:NP_001303575.1 Gene:OtopLc / 7354434 FlyBaseID:FBgn0259150 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_001349329.1 Gene:Otop2 / 237987 MGIID:2388365 Length:563 Species:Mus musculus

Alignment Length:532 Identity:122/533 (23%)
Similarity:213/533 (40%) Gaps:132/533 (25%)


  Fly   988 RLPPPIPVRRPSLLSPLGRRDAHYGSFYLRMGAVAFGIGSMIYSGLEFGQY---FELNPDTKCHN 1049
            |.|..:|.           ||||.|..:||.|.|.|||.:::....:.|.|   ||      |.:
Mouse    86 RCPDAVPY-----------RDAHAGPIWLRGGLVLFGICTLVMDVFKTGYYSSFFE------CQS 133

  Fly  1050 VLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEIL 1114
            .:..|.|..:..|:.:|.||::::.:.. ::.:..:.|.|||..:.||||:|:..::.|:.|:..
Mouse   134 AIKILHPIIQAVFVIVQTYFLWISAKDC-IHTHLDLTRCGLMFTLATNLAIWMAAVVDESVHQAH 197

  Fly  1115 TFYNPENRTLRISH-RI-PGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDAS 1177
            ::......|   || |: |...|.....:.||                  |..:..|..:.|...
Mouse   198 SYSGSHGNT---SHTRLNPDSKRAGGAAEEDP------------------CLCSTAICQIFQQGY 241

  Fly  1178 PFLFPCTIEYSLICAAILYVMWRSISR------PQTPTPQRPDMISSPMKRSPHHYSVDCARAHK 1236
            .:|:|..|||||..:.:|||||:::.|      ....||.|..:........|            
Mouse   242 FYLYPFNIEYSLFASTMLYVMWKNVGRLLASTHGHGHTPSRVSLFRETFFAGP------------ 294

  Fly  1237 GLFVGILILVLTIISLIIFFVLISRPE-FVAMAVTEVTICELLIYGTATIATLVGMI----QIRH 1296
              .:|:|:.|:.:...|::.|.:|... ....|:.......::..|..|:.:|.|.:    ..|.
Mouse   295 --VLGLLLFVVGLAVFILYEVQVSGERGHTRQALVIYYSFNIVCLGLMTLVSLSGSVIYRFDRRA 357

  Fly  1297 LQYDAYRSFSLDDILLVGAQTGSF---LYNIFTVIAGHFTLRSDDMLVPIN---ALASIVQTACQ 1355
            :.:....:.:||..||:||..|.:   .|:|..|:.|    ...|:...:|   ||..|.|...|
Mouse   358 MDHHKNPTRTLDVALLMGAALGQYAISYYSIVAVVVG----SPRDLQGALNLSHALLMIAQHTFQ 418

  Fly  1356 TMFILDASRR----------------QAV--------------------------SPE------- 1371
            .:||:::..|                |.:                          ||:       
Mouse   419 NVFIIESLHRGPPGAEPREMPPKEPCQGITFANLDAIRTLPSCPPTPRLVIPNLESPQEAVAIIS 483

  Fly  1372 ----HLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFY 1432
                |.|::..::|..|:|:.|:.:|.:.........|:.::::|||...|..|.::.:|..|||
Mouse   484 APRCHWRRRCLKDISLFLLLCNVILWIMPAFGARPHFSNTVEVDFYGYSLWAAIVNICLPFGIFY 548

  Fly  1433 RFHSTVCLCEIW 1444
            |.|:...|.|::
Mouse   549 RMHAVSSLLEVY 560

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OtopLcNP_001303575.1 Otopetrin 1015..1434 CDD:281218 111/494 (22%)
Otop2NP_001349329.1 Otopetrin 103..549 CDD:308685 110/492 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4740
Hieranoid 1 1.000
Homologene 1 1.000 H27803
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130839
orthoMCL 1 0.900 OOG5_133902
Panther 1 1.100 O PTHR21522
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3542
TreeFam 1 0.960
98.800

Return to query results.
Submit another query.