DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLc and Otop1

DIOPT Version :8

Sequence 1:NP_001303575.1 Gene:OtopLc / 7354434 FlyBaseID:FBgn0259150 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_766297.2 Gene:Otop1 / 21906 MGIID:2388363 Length:600 Species:Mus musculus

Alignment Length:741 Identity:142/742 (19%)
Similarity:259/742 (35%) Gaps:265/742 (36%)


  Fly   823 GGPDSSDPPSSPGGS--SSQPALSGSQADGQLALMYHSHQLTNYPVLPAIKRTHRPSFVYPPMPR 885
            |||.:   ||||..|  ||:.|.||..|               .|:.|            ||:.|
Mouse     3 GGPGA---PSSPAASSGSSRAAPSGIAA---------------CPLSP------------PPLAR 37

  Fly   886 -----------VKAGDALATLFSALYGKLLVVMGIAFPMA-EVISTYIPPS----------FYEV 928
                       ......||...|:.||..:.|.|:.|.:| .|.:|.:..|          ..::
Mouse    38 GSPQASGPRRGASVPQKLAETLSSQYGLNVFVAGLLFLLAWAVHATGVGKSDLLCVLTALMLLQL 102

  Fly   929 YYLYLYIGSMIFLLFMYATLIWGRPKLPVPIASPSKSATKASGTDSMDESDTDSNSVHHRLPPPI 993
            .::..|:|..    :|...||  |||                                       
Mouse   103 LWMLWYVGRS----YMQRRLI--RPK--------------------------------------- 122

  Fly   994 PVRRPSLLSPLGRRDAHYGSFYLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPAT 1058
                          |.|.|:.:||.....|...:::...|:...:...   ::|.:....:.|.|
Mouse   123 --------------DTHAGARWLRGSITLFAFITVVLGCLKVAYFIGF---SECLSATEGVFPVT 170

  Fly  1059 RMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRT 1123
            ......:|:||::.:.:.| :..:|.:.|||::|.:.|||.:|.|.::.|:||::   ...:.|.
Mouse   171 HAVHTLLQVYFLWGHAKDI-IMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQL---NEHKERL 231

  Fly  1124 LRISHRIPGHSRGHAII---QHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTI 1185
            :.:..       |:..|   .|.|..:...|                .:.:.:.....:|:|..|
Mouse   232 ITLGF-------GNITIVLDDHTPQCNCTPP----------------ALCSALSHGIYYLYPFNI 273

  Fly  1186 EYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFV----GILILV 1246
            ||.::.:.:|||:|::|.|       |.|        |..|..:.|  ...|:.|    |:.:|.
Mouse   274 EYQILASTMLYVLWKNIGR-------RVD--------SSQHQKMQC--RFDGVLVGSVLGLTVLA 321

  Fly  1247 LTIISLIIFFVLISRPE---------FVAMAVTEVTICELLIYGTA-TIATLVGMIQIRHLQYDA 1301
            .||..::::.:.|.|.:         |...|:|     .||:.|.| .:.:.:..:..:.|....
Mouse   322 ATIAVVVVYMIHIGRSKSKSESALIMFYLYAIT-----VLLLMGAAGLVGSWIYRVDEKSLDESK 381

  Fly  1302 YRSFSLDDILLVGAQTGSFLYNIFTVIA-------GHFTLRSDDMLVPINALASIVQTACQTMFI 1359
            ..:..||..|||...:||:|.:..:::|       ..:|..:    :|.:.|. ||:...|.:||
Mouse   382 NPARKLDVDLLVATGSGSWLLSWGSILAIACAETRPPYTWYN----LPYSVLV-IVEKYVQNIFI 441

  Fly  1360 LDASRRQAVS-PEHLR----------------------------------------KKPGRE--- 1380
            :::...:... ||.:|                                        ::.|:|   
Mouse   442 IESVHLEPEGVPEDVRTLRVVTVCSSEAAALAASTLGSQGMAQDGSPAVNGNLCLQQRCGKEDQE 506

  Fly  1381 ---------------------------IVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAW 1418
                                       |..|:.:.|:::|............:.::...:|...|
Mouse   507 SGWEGATGTTRCLDFLQGGMKRRLLRNITAFLFLCNISLWIPPAFGCRPEYDNGLEEIVFGFEPW 571

  Fly  1419 TIITHVSMPLAIFYRFHSTVCLCEIW 1444
            .|:.:::||.:||||.|:...|.|::
Mouse   572 IIVVNLAMPFSIFYRMHAAAALFEVY 597

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OtopLcNP_001303575.1 Otopetrin 1015..1434 CDD:281218 97/514 (19%)
Otop1NP_766297.2 Otopetrin 131..586 CDD:308685 96/512 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4740
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130839
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21522
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3542
TreeFam 1 0.960
76.900

Return to query results.
Submit another query.