DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and dpr21

DIOPT Version :10

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:243 Identity:70/243 - (28%)
Similarity:105/243 - (43%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LNNVISEDPEF-TDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRI 107
            :..|:...|.| |...:|:|...|....|.|.:||||:..|:|:......:|||.....|.:.|.
  Fly    43 MKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRF 107

  Fly   108 SVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVRE 172
            :..::|  :...|.|.|...|..|.|.|.||::| |....|..|..||.| |...|...:|.:..
  Fly   108 TSIYNK--QTGDWSLQIKFPQLRDSGIYECQVST-TPPVGYTMVFSVVEP-ITSILGGPEIYIDL 168

  Fly   173 GDNVTLRCKAKGSPEP--TIKWKRD------DGNKIVINKTLEVHDLETDSLELERISRLHMGAY 229
            |..|.|.|..|..|:|  :::|..:      |..:..::...|..|:.|..|.::|.|....|.|
  Fly   169 GSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQY 233

  Fly   230 LCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIE 277
            .|:.||....||:..| :..|....|...|.||.     .:...||::
  Fly   234 TCLPSNANSKSVNVHI-LKGDHPAAVQKSHLLVS-----ELLSLCFLQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 30/95 (32%)
Ig strand B 69..73 CDD:409353 1/3 (33%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 117..124 CDD:409353 2/6 (33%)
Ig 157..249 CDD:472250 27/99 (27%)
Ig strand B 176..180 CDD:409289 2/3 (67%)
Ig strand C 189..193 CDD:409289 0/3 (0%)
Ig strand E 213..218 CDD:409289 2/4 (50%)
Ig strand F 228..233 CDD:409289 2/4 (50%)
Ig strand G 242..245 CDD:409289 0/2 (0%)
IG_like 267..348 CDD:214653 2/11 (18%)
Ig strand C 283..287 CDD:409394
Ig strand E 313..319 CDD:409394
Ig strand F 329..334 CDD:409394
dpr21NP_001163838.2 Ig 71..149 CDD:472250 26/80 (33%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 2/3 (67%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 22/79 (28%)
Ig strand B 172..176 CDD:409353 2/3 (67%)
Ig strand C 187..191 CDD:409353 0/3 (0%)
Ig strand E 218..222 CDD:409353 1/3 (33%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.