DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and pigrl4.2

DIOPT Version :10

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001293038.1 Gene:pigrl4.2 / 105665605 ZFINID:ZDB-GENE-150409-10 Length:240 Species:Danio rerio


Alignment Length:234 Identity:51/234 - (21%)
Similarity:87/234 - (37%) Gaps:73/234 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AGNVGGSTLNNVISEDPEFTDVI--ENITVP--------------AGRNVKLACSVKNLGSYKVA 84
            ||.:...||:.|        .||  |.||:|              ...|..|.|||....::...
Zfish    15 AGTLSMKTLDRV--------PVIEGETITIPCLYDNKYKLNKKYWCNGNTWLGCSVVAYANHTGK 71

  Fly    85 WMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMC--QINTVTAKTQ 147
            |              .||..|          .|..:.:.:||....|.|.|.|  :|:.....::
Zfish    72 W--------------TITDYP----------DHNMFTVTLNNSTSSDSGHYWCAVEIDHHVDNSK 112

  Fly   148 YGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIK-W-----------KRDDGNKI 200
            |.::.|...|::  ::.||.:...:||:|::||..:.:.:..:| |           |:.|.:: 
Zfish   113 YLYLTVQKAPDV--SVLSSSVSGHKGDDVSVRCFYRSAYQNKLKQWCRIDDLTCFREKKTDTSQ- 174

  Fly   201 VINKTLEVHDLETDSLEL----ERISRLHMGAYLCIASN 235
              |.::::.|....|..:    .|:|  ..|.|.|...|
Zfish   175 --NSSVQISDDGESSFTVLMTGLRLS--DSGWYFCSVGN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 23/111 (21%)
Ig strand B 69..73 CDD:409353 1/3 (33%)
Ig strand C 82..86 CDD:409353 0/3 (0%)
Ig strand E 117..124 CDD:409353 1/6 (17%)
Ig 157..249 CDD:472250 21/95 (22%)
Ig strand B 176..180 CDD:409289 1/3 (33%)
Ig strand C 189..193 CDD:409289 2/15 (13%)
Ig strand E 213..218 CDD:409289 1/4 (25%)
Ig strand F 228..233 CDD:409289 2/4 (50%)
Ig strand G 242..245 CDD:409289
IG_like 267..348 CDD:214653
Ig strand C 283..287 CDD:409394
Ig strand E 313..319 CDD:409394
Ig strand F 329..334 CDD:409394
pigrl4.2NP_001293038.1 IgV_pIgR_like 30..117 CDD:409381 22/110 (20%)
Ig strand B 32..39 CDD:409381 4/6 (67%)
CDR1 39..47 CDD:409381 0/7 (0%)
Ig strand C 47..52 CDD:409381 0/4 (0%)
FR2 48..52 CDD:409381 0/3 (0%)
CDR2 53..68 CDD:409381 5/14 (36%)
Ig strand C' 61..64 CDD:409381 2/2 (100%)
Ig strand C' 66..68 CDD:409381 0/1 (0%)
FR3 71..102 CDD:409381 11/54 (20%)
Ig strand D 71..77 CDD:409381 3/19 (16%)
Ig strand E 81..89 CDD:409381 0/7 (0%)
Ig strand F 95..102 CDD:409381 3/6 (50%)
CDR3 103..111 CDD:409381 1/7 (14%)
FR4 111..117 CDD:409381 1/5 (20%)
Ig strand G 111..117 CDD:409381 1/5 (20%)
Ig 133..217 CDD:472250 18/82 (22%)
Ig strand B 139..143 CDD:409381 1/3 (33%)
Ig strand C 153..157 CDD:409381 1/3 (33%)
Ig strand E 188..192 CDD:409381 0/3 (0%)
Ig strand F 202..207 CDD:409381 2/4 (50%)
Ig strand G 211..214 CDD:409381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.