DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42306 and Ubxn6

Sequence 1:NP_001137700.1 Gene:CG42306 FlyBaseID:FBgn0259202 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_077752.1 Gene:Ubxn6 MGIID:1913780 Length:442 Species:Mus musculus

Alignment Length:132 Identity:31/133 (23%)
Similarity:47/133 (35%) Gaps:35/133 (26%)


  Fly     7 VESFNSTLQSIARQVEQ----------FAGVALTAAVDLRGNL---ESLTGDFRW-----ENGPI 53
            ||..:|......|:.|:          ...|.|.....|:|..   |.|:..||:     :|..:
Mouse   311 VERLSSLRTKAMREKEEQRELRKYTYALVRVRLPDGCLLQGTFYAREKLSALFRFVREALQNDWL 375

  Fly    54 AFTDLQAT---LLKVLIVLLLGTC-----VLAGYSWS--------IYGKVITEKFVRPSTLKEIE 102
            .| :|:|:   .|:....|.|..|     .|..:||.        ..|....:..:||..|..||
Mouse   376 PF-ELRASGGQKLEENEALALNECGLVPSALLTFSWDASVLEDIRAAGAEPAKSVLRPELLAAIE 439

  Fly   103 EL 104
            :|
Mouse   440 QL 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42306NP_001137700.1 None
Ubxn6NP_077752.1 Mediates interaction with LMAN1. {ECO:0000250|UniProtKB:Q9BZV1} 1..10
VCP/p97-interacting motif (VIM). {ECO:0000250|UniProtKB:Q9BZV1} 51..63
PUB_UBXD1 158..261 CDD:198418
UBQ 334..407 CDD:294102 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.