DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42306 and ubxn6

DIOPT Version :10

Sequence 1:NP_001137700.1 Gene:CG42306 / 7354425 FlyBaseID:FBgn0259202 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001038245.2 Gene:ubxn6 / 554960 ZFINID:ZDB-GENE-030131-5680 Length:437 Species:Danio rerio


Alignment Length:45 Identity:14/45 - (31%)
Similarity:19/45 - (42%) Gaps:2/45 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LLGTCVLAGYSWSIYGKVIT-EKFVRPSTLKEIE-ELKLSVAKLK 112
            :.|...||........||.| :..:|....:|:| |....||.||
Zfish    51 MAGAAALARIEQQHRPKVHTSQDAIRNQVKRELEAEAAAVVASLK 95

Return to query results.
Submit another query.