DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42306 and ubxn6

Sequence 1:NP_001137700.1 Gene:CG42306 FlyBaseID:FBgn0259202 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001005818.1 Gene:ubxn6 XenbaseID:XB-GENE-971811 Length:427 Species:Xenopus tropicalis

Alignment Length:62 Identity:16/63 (25%)
Similarity:28/63 (44%) Gaps:7/63 (11%)


  Fly    53 IAFTD-LQATLLKVLIV------LLLGTCVLAGYSWSIYGKVITEKFVRPSTLKEIEELKLS 107
            ::.|| ..|.:||:...      :.|||..:|.|..:|......||:.|.....::.:.|:|
 Frog   136 LSTTDPTSAAILKIHTYNKDREKVKLGTETIAKYMNNIISHPEEEKYCRIKLSNKVFQEKIS 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42306NP_001137700.1 None
ubxn6NP_001005818.1 PUB_UBXD1 146..249 CDD:198418 13/53 (25%)
TGS 318..395 CDD:330245
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.