DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42306 and CG33722

DIOPT Version :10

Sequence 1:NP_001137700.1 Gene:CG42306 / 7354425 FlyBaseID:FBgn0259202 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001027152.1 Gene:CG33722 / 3772658 FlyBaseID:FBgn0064126 Length:478 Species:Drosophila melanogaster


Alignment Length:70 Identity:21/70 - (30%)
Similarity:31/70 - (44%) Gaps:11/70 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PIAFTDLQATLLKVLIVLLLGTCVLAGYSWSIYGKVITEKFVRPSTLKEIEELKLSVAKLKLPKE 116
            |.:|.||....||:::..|..|.     |......::|.|      |:|:|..|..:|||...|:
  Fly   307 PDSFFDLTVNDLKMVLRDLKRTS-----SGDDDAPLLTAK------LRELERQKAMLAKLNQYKD 360

  Fly   117 HSPRI 121
            ...||
  Fly   361 CVLRI 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42306NP_001137700.1 None
CG33722NP_001027152.1 Ubl_ASPSCR1_like 5..73 CDD:340522
UBX1_UBXN9 81..157 CDD:340595
UBX2_UBXN9 361..433 CDD:340535 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.