DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42306 and CG33722

Sequence 1:NP_001137700.1 Gene:CG42306 FlyBaseID:FBgn0259202 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001027152.1 Gene:CG33722 FlyBaseID:FBgn0064126 Length:478 Species:Drosophila melanogaster

Alignment Length:70 Identity:21/71 (30%)
Similarity:31/71 (44%) Gaps:11/71 (15%)


  Fly    52 PIAFTDLQATLLKVLIVLLLGTCVLAGYSWSIYGKVITEKFVRPSTLKEIEELKLSVAKLKLPKE 116
            |.:|.||....||:::..|..|.     |......::|.|      |:|:|..|..:|||...|:
  Fly   307 PDSFFDLTVNDLKMVLRDLKRTS-----SGDDDAPLLTAK------LRELERQKAMLAKLNQYKD 360

  Fly   117 HSPRI 121
            ...||
  Fly   361 CVLRI 365

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42306NP_001137700.1 None
CG33722NP_001027152.1 TUG-UBL1 8..71 CDD:288347
UBQ 360..429 CDD:294102 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2699
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.