DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: UCP2 and CG1907

Sequence 1:XP_024304442.1 Gene:UCP2 HGNCID:12518 Length:310 Species:Homo sapiens
Sequence 2:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster

Alignment Length:264 Identity:83/265 (31%)
Similarity:125/265 (47%) Gaps:14/265 (5%)


Human    42 LQIQGESQGPVRATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQ 106
            :||.|...|      ..:||..:..|.|:|..|||.:||.|:.|.|.||.::.:.|:|:|..:..
  Fly    45 MQISGAGSG------KKEYRSSLHCIQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLND 103

Human   107 -FYTKGSEHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQAR--AGGGRRYQSTVNAYKTIA 168
             |..|......|...:..|:..||....:..|.:|..||..:..|  ....|.|.:..||...|.
  Fly   104 LFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARIT 168

Human   169 REEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANL-MTDDLPCHFTSAFGAGFCTTVI 232
            ||||...||:|:.|.|.|..:||..:|.:|...|.......| |.:.:..||.::..:|..||:.
  Fly   169 REEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTIT 233

Human   233 ASPVDVVKTRYMNSAL----GQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYE 293
            :.|:|:.|||..|..:    .:|.......|.:.::||..|.:|||.|.:.|||...|:.|:..|
  Fly   234 SMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILE 298

Human   294 QLKR 297
            ||.:
  Fly   299 QLNQ 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UCP2XP_024304442.1 Mito_carr <42..112 CDD:332982 24/71 (34%)
Mito_carr 113..207 CDD:278578 29/96 (30%)
Mito_carr 218..300 CDD:278578 28/85 (33%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 24/70 (34%)
Mito_carr 118..207 CDD:278578 28/89 (31%)
Mito_carr 219..307 CDD:278578 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.