DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: atf7 and kay

Sequence 1:NP_001039217.1 Gene:atf7 XenbaseID:XB-GENE-1216213 Length:471 Species:Xenopus tropicalis
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:355 Identity:83/356 (23%)
Similarity:142/356 (40%) Gaps:99/356 (28%)


 Frog   139 TSTPTIVRPGSLPLHLGYDPLHPTLPSPTSVITQAPPSNRQLGSPGSSVPLMMHLGNGHTVPFLP 203
            |.|||..|  ::...||:      |.|.|.       ::|..|..|.:||.:             
  Fly   251 TLTPTTTR--NIEDTLGH------LLSDTQ-------TDRVAGCAGFAVPKV------------- 287

 Frog   204 GPHVQMPSVISLARPLSMVPNIP-GIPGPPVIG------GSGHLSPSSYSAHSEAKMRLKASLTQ 261
                 :|:.|.:   |.|  .|| |:...|:..      |.|..|..|.:::::.:|..:...|.
  Fly   288 -----LPNAIDV---LGM--GIPTGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDTTD 342

 Frog   262 QAPS---------------SLNGG--------MAMVTSRPEQSQILVQHPDAPSPAQPQVSPAQP 303
            .:.:               |:|||        :|.|:|....:.:      ..|.|....:||: 
  Fly   343 TSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRGSASV------GSSNANTSNTPAR- 400

 Frog   304 TPSTGGRR-RRAADEDPDERRQRFL--ERNRAAASRCRQKRKVWVCSLEKKAEELTTQNVQLNNE 365
              ..|||| .|:.:..|:|.::|.:  |||:.||:|||::|......|.::.|:|..:...:..|
  Fly   401 --RGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKE 463

 Frog   366 VTLLRNEVAQLKQLLLAHKDCPVTALQKKNQVYLENLKDTCDATGSPGPVTQHSSLTAASPNGLR 430
            :.:|.|...||:.||..|:    ...||.....|..:  ||:...:|      :.|.:|..:|..
  Fly   464 IEVLTNSKNQLEYLLATHR----ATCQKIRSDMLSVV--TCNGLIAP------AGLLSAGSSGSG 516

 Frog   431 SPAEH------MATSVLTQM-ASQRTDGHS 453
            :.:.|      .:...:|.| |:..:.|.|
  Fly   517 ASSHHNHNSNDSSNGTITGMDATLNSTGRS 546

Known Domains:


GeneSequenceDomainRegion External IDIdentity
atf7NP_001039217.1 C2H2 Zn finger 9..31 CDD:275368
GCN4_cent 47..84 CDD:213399
bZIP_ATF2 322..382 CDD:269835 20/62 (32%)
coiled coil 322..382 CDD:269835 20/62 (32%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 20/61 (33%)
coiled coil 421..480 CDD:269869 20/59 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.