DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE3A and HUL4

DIOPT Version :8

Sequence 1:NP_000453.2 Gene:UBE3A / 7337 HGNCID:12496 Length:875 Species:Homo sapiens
Sequence 2:NP_012570.3 Gene:HUL4 / 853494 SGDID:S000003797 Length:892 Species:Saccharomyces cerevisiae

Alignment Length:826 Identity:223/827 (27%)
Similarity:369/827 (45%) Gaps:186/827 (22%)


Human   196 AACSAAAMEEDSE-----ASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLLSNEKIETA 255
            :||....:.::.|     .||:.|..:.:|...:.:...||:.      |...|.:|..|:....
Yeast   103 SACQVTVIVKEPEINSNLESSTHISCTLEGLQMVVRRCHDDLQ------RLKKTGILDKERKGLI 161

Human   256 FLNALVYLSPNVECDLTYHNVYSRDPNYL------NL----------FIIVMENRNLHSPEYLEM 304
            |...:.||...      :|:|...:.::|      |:          |..::.|.....|.|   
Yeast   162 FQPVITYLLDR------FHDVSILNRSFLVHDGGKNIKMLNYEVLQRFYSILSNLPTRKPYY--- 217

Human   305 ALPLFCKAMSKLPLAAQGKLIRL----W-------------------SK--YNADQIRRM----- 339
            ::...|..:.|.....:|:.:::    |                   ||  :...|||.:     
Yeast   218 SMLCCCNDLLKRITINKGENLQILQYRWLLIILNIPTIRTCLIRDRKSKNVFETQQIRAVSYELA 282

Human   340 -----------METFQQLI-----------TYKV--------------ISNEFNSR---NLVNDD 365
                       .:|.||||           :|:|              :|||.::|   |.|..:
Yeast   283 KRCIGYLSNLSTKTSQQLIQSLRRTPTDNFSYQVEILNLYINFQFSRLLSNELSNRTAKNNVKPE 347

Human   366 D--------------------AIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQ 410
            |                    .|.|.|...:...:.:.|..::.....:.:::..|..:::||..
Yeast   348 DEMRSRLRRHHTTGHEFLSTRPISAQSNDKQGSGFTHPVNNKMKFKFFQYEEDWHIHSAAKLTFI 412

Human   411 ELLGEERRNKKGPRVDPLETELGVK-----TLDCRKPLIPFEEFINE--------PLNEVLEMDK 462
            ..:...|||.:|        .|.::     |||    .|.:::..:.        .:|:::|...
Yeast   413 YYVANTRRNGRG--------ALSIQSFYNITLD----FIDYKQDFDHWRGVAQKTKMNQLIEEWG 465

Human   463 DYTFFKVETENKFSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKV 527
            :.|     |:..|||...||||:...|...:.|:.|..|..|.....|.||.:|:.::.|.::||
Yeast   466 NST-----TKKCFSFCKYPFILSLGIKISIMEYEIRRIMEHEAEQAFLISLDKGKSVDVYFKIKV 525

Human   528 RRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTY 592
            |||.|..|:|..::    |:..||.|.|.:||..|.|:|.||:.||:|.|:.:.:|||..|:|.|
Yeast   526 RRDVISHDSLRCIK----EHQGDLLKSLRIEFVNEPGIDAGGLRKEWFFLLTKSLFNPMNGLFIY 586

Human   593 DESTKLFWF--NPSSFE-TEGQ------FTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTF 648
            .:.:...||  :|.:|: ::|:      :.|.|:|:||||:|:.|||:.||..:|:||..:..:|
Yeast   587 IKESSRSWFAIDPPNFDKSKGKNSQLELYYLFGVVMGLAIFNSTILDLQFPKALYKKLCSEPLSF 651

Human   649 RDLGDSHPVLYQSLKDLLEY-EGNVEDDMMITFQISQTDLFGNPMMYDLK-----------ENGD 701
            .|..:..|...::|..:|.| |.|.||...:||:.:..:  .|.::.|.|           |||.
Yeast   652 EDYSELFPETSRNLIKMLNYTEDNFEDVFSLTFETTYRN--NNWILNDSKSSKEYVTVELCENGR 714

Human   702 KIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSR--- 763
            .:|||..|:.|||..:.::.|.||:|.|:..|..||..|..|.....||..||:|.|:||..   
Yeast   715 NVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIKLFNSEELERLVCGDEEQT 779

Human   764 NLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIA 828
            ..||::|...|:|.||::.||..:..||||:.|:....::..|||.|.:||.|..|:..:...|:
Yeast   780 KFDFKSLRSVTKYVGGFSDDSRAVCWFWEIIESWDYPLQKKLLQFVTASDRIPATGISTIPFKIS 844

Human   829 KNGP-DTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFG 873
            ..|. |::.||.:|||||.:.|..||||:||:.:||.||..::|:|
Yeast   845 LLGSHDSDDLPLAHTCFNEICLWNYSSKKKLELKLLWAINESEGYG 890

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBE3ANP_000453.2 AZUL 29..83 CDD:318707
HECTc 523..873 CDD:238033 138/375 (37%)
HUL4NP_012570.3 HUL4 1..892 CDD:227354 223/827 (27%)
HECTc 521..890 CDD:238033 138/375 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1004543
orthoMCL 1 0.900 OOG5_127640
Panther 1 1.100 O PTHR45622
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.