DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE3A and ube3a

DIOPT Version :8

Sequence 1:NP_000453.2 Gene:UBE3A / 7337 HGNCID:12496 Length:875 Species:Homo sapiens
Sequence 2:NP_001007319.1 Gene:ube3a / 792398 ZFINID:ZDB-GENE-041114-190 Length:857 Species:Danio rerio

Alignment Length:857 Identity:740/858 (86%)
Similarity:796/858 (93%) Gaps:5/858 (1%)


Human    24 MKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPS 88
            |||||||||||||||||||||||||||||.|.|.|.|.||||||||||||||||.||||||||||
Zfish     1 MKRAAAKHLIERYYHQLTEGCGNEACTNEACGSSPGFQRMDNNAAAIKALELYKNNAKLCDPHPS 65

Human    89 KKGASSAYLENS-KGAPN-NSCSEIKMNKKG---ARIDFKDVTYLTEEKVYEILELCREREDYSP 148
            |||||||:.||| |||.| ::||..|||.|.   .|.||:|:.:|||:||||||.:|.|.|||||
Zfish    66 KKGASSAFPENSAKGAHNFSACSNGKMNHKDLPPTREDFRDLNFLTEDKVYEILSICSETEDYSP 130

Human   149 LIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSR 213
            |||||||||||||:|||||||.||||||||||||||||||||||||.|:.|:.|||.:.|||:|.
Zfish   131 LIRVIGRVFSSAESLVQSFRKAKQHTKEELKSLQAKDEDKDEDEKETASGSSTAMEVEPEASASS 195

Human   214 IGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYS 278
            ...||.|:||:|||||.:|||||||:||||.|||||||||.|||||||||||||||||||||||:
Zfish   196 GDGSSHGENNVQKLGPVEVSVDIDAVRRVYDRLLSNEKIEAAFLNALVYLSPNVECDLTYHNVYA 260

Human   279 RDPNYLNLFIIVMENRNLHSPEYLEMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETF 343
            .||||||:|||||||.|||||||||:|||.||||||||||.|..||.||||:|..|||||::|||
Zfish   261 ADPNYLNVFIIVMENSNLHSPEYLEIALPQFCKAMSKLPLPALAKLARLWSQYGVDQIRRLVETF 325

Human   344 QQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELT 408
            ||||||.||||||:|.||||:||.:|||:||||:||||||:||::||:||||||:||||||||||
Zfish   326 QQLITYTVISNEFSSDNLVNEDDGVVAATKCLKIVYYANVLGGDLDTDHNEEDDDEPIPESSELT 390

Human   409 LQELLGEERRNKKGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETEN 473
            |||||||||||||||||||||||:|::..|||||||||||||||||||||||||||||||||||:
Zfish   391 LQELLGEERRNKKGPRVDPLETEMGIRASDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETES 455

Human   474 KFSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALV 538
            |||||||||||||||||||||||||||||||||||.|||||||||||||||||||||||||||||
Zfish   456 KFSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITALYSLVQGQQLNPYLRLKVRRDHIIDDALV 520

Human   539 RLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNP 603
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish   521 RLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNP 585

Human   604 SSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEY 668
            ||||.||||||||||||||||||||||||||||:||||||||||||||.||||||:||||||:||
Zfish   586 SSFENEGQFTLIGIVLGLAIYNNCILDVHFPMVIYRKLMGKKGTFRDLADSHPVLFQSLKDLMEY 650

Human   669 EGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAF 733
            |||||:|||||||||||||||||:||||||:|||||:||||||:||.||::|:||||||||||||
Zfish   651 EGNVEEDMMITFQISQTDLFGNPLMYDLKESGDKIPVTNENRKDFVALYAEYMLNKSVEKQFKAF 715

Human   734 RRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFT 798
            |||||||||||||||||||||||||||||||||||||||:|||||||.:||.:||:|||.||||.
Zfish   716 RRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEESTEYDGGYNKDSRIIRDFWETVHSFE 780

Human   799 DEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLL 863
            .|:||||||||||||||||||||||||||||||||::||||||||||||||||||:.||||||||
Zfish   781 QEKKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDSDRLPTSHTCFNVLLLPEYSTVEKLKERLL 845

Human   864 KAITYAKGFGML 875
            ||||||||||||
Zfish   846 KAITYAKGFGML 857

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBE3ANP_000453.2 AZUL 29..83 CDD:318707 48/54 (89%)
HECTc 523..873 CDD:238033 322/350 (92%)
ube3aNP_001007319.1 AZUL 6..60 CDD:293166 48/54 (89%)
HECTc 505..855 CDD:238033 322/350 (92%)
HECTc 532..854 CDD:214523 294/322 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C366127009
eggNOG 1 0.900 E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7988
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D276447at33208
OrthoFinder 1 1.000 FOG0007635
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127640
Panther 1 1.100 LDO PTHR45622
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 1 1.500
1111.220

Return to query results.
Submit another query.