DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE3A and ube3a

DIOPT Version :8

Sequence 1:NP_000453.2 Gene:UBE3A / 7337 HGNCID:12496 Length:875 Species:Homo sapiens
Sequence 2:XP_012812141.1 Gene:ube3a / 407881 XenbaseID:XB-GENE-948557 Length:908 Species:Xenopus tropicalis

Alignment Length:868 Identity:795/869 (91%)
Similarity:842/869 (97%) Gaps:4/869 (0%)


Human    12 GEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELY 76
            |:|.|:::|.||||||||||||||||||||||||||.||||||||||||||||||||||||||||
 Frog    41 GDPYSENLENSRMKRAAAKHLIERYYHQLTEGCGNETCTNEFCASCPTFLRMDNNAAAIKALELY 105

Human    77 KINAKLCDPHPSKKGASSAYLE-NSKGAPNNSCSEIKMNKK---GARIDFKDVTYLTEEKVYEIL 137
            |:|||||||||||||.||:||| |||.|.||||:|.|||||   |.|.||||||:|:||||||||
 Frog   106 KVNAKLCDPHPSKKGTSSSYLENNSKSAHNNSCTERKMNKKDLHGPRDDFKDVTFLSEEKVYEIL 170

Human   138 ELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAA 202
            |||||:||||||||||||||||||||||||||.|.||||||||||.||||||||||||||.||||
 Frog   171 ELCREKEDYSPLIRVIGRVFSSAEALVQSFRKAKHHTKEELKSLQEKDEDKDEDEKEKAASSAAA 235

Human   203 MEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLLSNEKIETAFLNALVYLSPNV 267
            |||||.|||||:.|:||||||:|||||::||:||:|:||||.|||||||||||||||||||||||
 Frog   236 MEEDSGASSSRLSDNSQGDNNIQKLGPEEVSLDIEAVRRVYHRLLSNEKIETAFLNALVYLSPNV 300

Human   268 ECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPEYLEMALPLFCKAMSKLPLAAQGKLIRLWSKYN 332
            ||||||||||||||||||||||||||.|||||||||||||||||||||||||||.|||||||||:
 Frog   301 ECDLTYHNVYSRDPNYLNLFIIVMENGNLHSPEYLEMALPLFCKAMSKLPLAAQAKLIRLWSKYS 365

Human   333 ADQIRRMMETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDD 397
            |:|||||||||||||||||||||||||||||||||||||:||||||||:||||||::|:||||:|
 Frog   366 AEQIRRMMETFQQLITYKVISNEFNSRNLVNDDDAIVAATKCLKMVYYSNVVGGEIETDHNEEED 430

Human   398 EEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDK 462
            :||:||||||||||||||||||||||||||||||||||::||||||||||||:|||||:||||||
 Frog   431 DEPVPESSELTLQELLGEERRNKKGPRVDPLETELGVKSIDCRKPLIPFEEFVNEPLNDVLEMDK 495

Human   463 DYTFFKVETENKFSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKV 527
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog   496 DYTFFKVETENKFSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKV 560

Human   528 RRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTY 592
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog   561 RRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTY 625

Human   593 DESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPV 657
            |||||..||||||||||||||||||||||||||||||||||||||||||||||||||||.|||||
 Frog   626 DESTKHSWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLADSHPV 690

Human   658 LYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYIL 722
            ||||||:|||||||||:|||:|||||||||||||:|:||||||||||||||||||||:||:||||
 Frog   691 LYQSLKELLEYEGNVEEDMMMTFQISQTDLFGNPLMHDLKENGDKIPITNENRKEFVSLYTDYIL 755

Human   723 NKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLI 787
            ||||||||||||||||||||||||||||||||||||||||||||||||::||||||||||||.:|
 Frog   756 NKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALKDTTEYDGGYTRDSNII 820

Human   788 REFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEY 852
            :||||||:|||:|||||||||||||||||||||||||||||||||||:|||||||||||||||||
 Frog   821 KEFWEIVNSFTEEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTDRLPTSHTCFNVLLLPEY 885

Human   853 SSKEKLKERLLKAITYAKGFGML 875
            |:|||||||||||||||||||||
 Frog   886 SNKEKLKERLLKAITYAKGFGML 908

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBE3ANP_000453.2 AZUL 29..83 CDD:318707 52/54 (96%)
HECTc 523..873 CDD:238033 331/350 (95%)
ube3aXP_012812141.1 AZUL 58..112 CDD:293166 52/54 (96%)
HECTc 556..906 CDD:238033 331/350 (95%)
HECTc 583..905 CDD:214523 303/322 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C366044202
eggNOG 1 0.900 E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7988
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D276447at33208
OrthoFinder 1 1.000 FOG0007635
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.