DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE3A and Ube3a

DIOPT Version :8

Sequence 1:NP_000453.2 Gene:UBE3A / 7337 HGNCID:12496 Length:875 Species:Homo sapiens
Sequence 2:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster

Alignment Length:976 Identity:397/977 (41%)
Similarity:560/977 (57%) Gaps:161/977 (16%)


Human    24 MKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLC----- 83
            |||:|.:.||:||:|||..||||..|:|..|||......|..|..|.:||:|:..:|:||     
  Fly    35 MKRSAVRSLIKRYFHQLQSGCGNANCSNANCASSGKVAPMTPNEVAARALQLFSQDAQLCEAFTS 99

Human    84 --------------DPHPSKKGASSAYLENSK--------------------GAPNNSCSEIKMN 114
                          |...|..|:|::.:.::.                    .:|..:.|..:::
  Fly   100 EANSPQDVDMLSPNDSSSSSSGSSTSTITSASTTTTTSRQSQSTPAAVVVPVSSPYLTQSVPQLD 164

Human   115 KKGARIDFKD----------VTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRK 169
            ..||.....|          |..|....:..:.|.||..:.|..:...||.||||.:.|.:||.:
  Fly   165 IAGAEHSSGDSEPCTPTLAPVHSLDANSLIALYEQCRAADSYDRICHAIGVVFSSVDRLGKSFIR 229

Human   170 VKQH-----------------TKEELKSLQA---KDEDKDE--DEKEKAACSAAAMEEDSEASSS 212
            ..:.                 .||:|::|:.   ||||..:  ||:.::|.:|.|..|..|:.: 
  Fly   230 SAEPAASSSLQELLANSPGALNKEQLRTLEGEHDKDEDSTQQVDEQSESAANATATAESVESEA- 293

Human   213 RIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLLSN---EKIETAFLNALVYLSPNVECDLTYH 274
               :..:.|:::......|..||:..:||| .|||..   ..|.....::::.||..|       
  Fly   294 ---EPEEEDDDVCSSQSSDTLVDLPGLRRV-QRLLFGCQIRAITEKLTSSVIQLSDWV------- 347

Human   275 NVYSRD--PNYLNLFIIVME-----NRNLHSPEYLEMALPLFCKAMSKLPLAAQGKLIRLWSKYN 332
             :|.|.  ...::..:|..:     |.::...:||:..||..|:|.|.:|:.||.:|.|:|:.:.
  Fly   348 -IYMRTDWERVIHCLVICFDLATNTNNSVVDMDYLDRVLPKLCQAASAMPVPAQARLARIWAAHC 411

Human   333 ADQIRRMMETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVD-------- 389
            :||:..::...||.||.:|:.:|.:.|    ::::|::.:|.||:|:|||::..|::        
  Fly   412 SDQLHSLIAACQQQITLQVLLDEESMR----ENESIISVTKVLKIVFYANILASELERPSCRVPL 472

Human   390 TNHNE----------EDD--------EEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKT 436
            .:..|          |||        |..:|:.:|                   |..|.||.|..
  Fly   473 EDRTEAATASGSAAVEDDLFVYNSLLEPHMPKFAE-------------------DQFEKELQVSA 518

Human   437 LDCRKPLIPFEEFINEPLNEVLEMDKDYTFFK---VETE------NKFSFMTCPFILNAVTKNLG 492
            :||||||||.|||.||.|:|.::|..||..:|   :|:|      |.||||...|||...||...
  Fly   519 IDCRKPLIPLEEFYNEALSENIQMHHDYLSYKTLAMESEIGSGHANYFSFMLYAFILTPSTKVDA 583

Human   493 LYYDNRIRMYSERRITVLYSLVQ-----GQQLNPY--LRLKVRRDHIIDDALVRLEMIAMENPAD 550
            ||||:|:||||| |.:.|:|::.     ||:.||.  |:|.||||.:|:|||:.|||:||.||.|
  Fly   584 LYYDSRMRMYSE-RYSSLHSILNNIGQVGQEDNPRPDLKLTVRRDQLINDALIGLEMVAMSNPKD 647

Human   551 LKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLI 615
            |||||.|||.||||:||||||||||||:|||||||..|||...|.|...|||.:.||...|||||
  Fly   648 LKKQLVVEFVGEQGIDEGGVSKEFFQLIVEEIFNPAFGMFIQQEETNNMWFNATPFENGAQFTLI 712

Human   616 GIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEG-NVEDDMMIT 679
            ||::|||||||..|.|:|||||||||:|..|||.||.|..|.||:|||.:|:|:| ::|:....|
  Fly   713 GIIIGLAIYNNVTLAVNFPMVVYRKLIGYCGTFADLSDWSPALYKSLKSMLDYQGQDMEEVFEQT 777

Human   680 FQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNES 744
            |:||.:|:||:.:.::|..||..:.:...|::.|||||||::||.::|:||.|||:||.|||:||
  Fly   778 FKISYSDVFGDVVQHELVPNGQDVLVGQHNKELFVNLYSDFLLNTNIEQQFNAFRKGFEMVTDES 842

Human   745 PLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFT 809
            |||.||||||||:|:||||..||..||.:|.|:||||..|..|::||.|||:...|.|...|:||
  Fly   843 PLKLLFRPEEIEMLVCGSREFDFVELENSTVYEGGYTEKSQYIQDFWSIVHAMPSEDKHKLLEFT 907

Human   810 TGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGM 874
            ||:.|.|||||..|:::|.::|||::|||||||||||||||||||:|||:|||:|||.|:|||||
  Fly   908 TGSARVPVGGLKCLRLLITRHGPDSDRLPTSHTCFNVLLLPEYSSREKLEERLMKAINYSKGFGM 972

Human   875 L 875
            |
  Fly   973 L 973

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBE3ANP_000453.2 AZUL 29..83 CDD:318707 24/54 (44%)
HECTc 523..873 CDD:238033 217/351 (62%)
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 24/54 (44%)
HECTc 620..971 CDD:238033 217/351 (62%)
HECTc 647..970 CDD:214523 199/323 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C366238616
eggNOG 1 0.900 E1_COG5021
Hieranoid 1 1.000
Homologene 1 1.000 H7988
Inparanoid 1 1.050 651 1.000 Inparanoid score I775
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D276447at33208
OrthoFinder 1 1.000 FOG0007635
OrthoInspector 1 1.000 T1074836
orthoMCL 1 0.900 OOG5_127640
Panther 1 1.100 LDO PTHR45622
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5642
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.