DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE3A and Ube3a

DIOPT Version :8

Sequence 1:NP_000453.2 Gene:UBE3A / 7337 HGNCID:12496 Length:875 Species:Homo sapiens
Sequence 2:NP_001178766.1 Gene:Ube3a / 361585 RGDID:1306361 Length:868 Species:Rattus norvegicus

Alignment Length:869 Identity:831/870 (96%)
Similarity:851/870 (98%) Gaps:5/870 (1%)


Human     7 CYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIK 71
            |...|||.||:||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     5 CKRSSGESQSEDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIK 69

Human    72 ALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEI 136
            ||||||||||||||||||||||||||||||||.||  ||||||||.   :||:|.||||||||||
  Rat    70 ALELYKINAKLCDPHPSKKGASSAYLENSKGASNN--SEIKMNKKE---EFKEVDYLTEEKVYEI 129

Human   137 LELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAA 201
            .|.||||||||||||||||:||||||||||||||||||||||||||.||||||||||||||||||
  Rat   130 YEFCREREDYSPLIRVIGRIFSSAEALVQSFRKVKQHTKEELKSLQEKDEDKDEDEKEKAACSAA 194

Human   202 AMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLLSNEKIETAFLNALVYLSPN 266
            ||||||||||||:|||||||||:||||||||:||||||||||:.|||:|||||||||||||||||
  Rat   195 AMEEDSEASSSRMGDSSQGDNNVQKLGPDDVTVDIDAIRRVYSSLLSDEKIETAFLNALVYLSPN 259

Human   267 VECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPEYLEMALPLFCKAMSKLPLAAQGKLIRLWSKY 331
            |||||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   260 VECDLTYHNVYTRDPNYLNLFIIVMENRNLHSPEYLEMALPLFCKAMSKLPLAAQGKLIRLWSKY 324

Human   332 NADQIRRMMETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEED 396
            :||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||||||||
  Rat   325 SADQIRRMMETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGDVDTNHNEED 389

Human   397 DEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMD 461
            |||||||||||||||||||||||||||||||||||:||||||||||||.||||||||||:|||||
  Rat   390 DEEPIPESSELTLQELLGEERRNKKGPRVDPLETEIGVKTLDCRKPLISFEEFINEPLNDVLEMD 454

Human   462 KDYTFFKVETENKFSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLK 526
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   455 KDYTFFKVETENKFSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLK 519

Human   527 VRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFT 591
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   520 VRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFT 584

Human   592 YDESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHP 656
            |||:|:|||||||||||||||||||||||||||||||||||||||||||||||||||.|||||||
  Rat   585 YDEATRLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFCDLGDSHP 649

Human   657 VLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYI 721
            :|||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||||
  Rat   650 ILYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVSLYSDYI 714

Human   722 LNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVL 786
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||:
  Rat   715 LNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVV 779

Human   787 IREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPE 851
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   780 IREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPE 844

Human   852 YSSKEKLKERLLKAITYAKGFGML 875
            ||||||||||||||||||||||||
  Rat   845 YSSKEKLKERLLKAITYAKGFGML 868

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBE3ANP_000453.2 AZUL 29..83 CDD:318707 54/54 (100%)
HECTc 523..873 CDD:238033 343/350 (98%)
Ube3aNP_001178766.1 AZUL 27..81 CDD:293166 54/54 (100%)
HECTc 516..866 CDD:238033 343/350 (98%)
HECTc 543..865 CDD:214523 315/322 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C365874958
eggNOG 1 0.900 E1_COG5021
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H7988
Inparanoid 1 1.050 1666 1.000 Inparanoid score I2133
OMA 1 1.010
OrthoDB 1 1.010 D13733at314146
OrthoFinder 1 1.000 FOG0007635
OrthoInspector 1 1.000 T2472247
orthoMCL 1 0.900 OOG5_127640
Panther 1 1.100 LDO PTHR45622
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1414.270

Return to query results.
Submit another query.