DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE3A and mug30

DIOPT Version :8

Sequence 1:NP_000453.2 Gene:UBE3A / 7337 HGNCID:12496 Length:875 Species:Homo sapiens
Sequence 2:NP_596534.1 Gene:mug30 / 2541379 PomBaseID:SPBP8B7.27 Length:807 Species:Schizosaccharomyces pombe

Alignment Length:928 Identity:237/929 (26%)
Similarity:387/929 (42%) Gaps:212/929 (23%)


Human    11 SGEPQSDDIEASRMKRAAAKHLIERY----------YHQL--TEGCGN-EACTNEFCASCPTFLR 62
            |...:.|:...|::.|...:.:.:|.          :|:.  .:..|| |......|..|.:.||
pombe    27 SSRSELDNNTNSKISRRLRELVCQRMGENPLRLRQSFHETISNDSYGNSEKLVIRPCICCNSVLR 91

Human    63 MDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTY 127
            ....|...:......:|    |.:....|                 |:||.........|..|.:
pombe    92 YPAQAMCFRCSLCMTVN----DVYFCLSG-----------------SQIKTKASTDGSQFISVEH 135

Human   128 LTE--EKVYEILELCREREDY--------SPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQ 182
            ..|  .:....|:|.::|...        .||..:|..||.|...|.:.|               
pombe   136 FVETIHQTRSALQLAKQRTGNVQAIVAAGLPLRELISLVFGSPPILNKLF--------------- 185

Human   183 AKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLL 247
                      ..|..||              |..|......:.:|..|..::||         |:
pombe   186 ----------SVKNGCS--------------IQSSGLNYKLIYQLYHDITNLDI---------LI 217

Human   248 SNEKIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSP-----EYLEMALP 307
            :||.:..            :|..|....:|..||......:|::||..|:|.     ......|.
pombe   218 TNELLRA------------IESLLRRPMLYCHDPADYQYLLILLENPLLNSKSKNIVNKSSSILK 270

Human   308 LFCKAMSKLPLAAQGKLIRLWSK--YNADQ-IRRMMETFQQLITYKVISNEFNSRN----LVNDD 365
            .....:|.|........|..:.|  ||..: .||.::...:.|..:::  |..|||    ..|:|
pombe   271 RILGVLSNLNEKTHHFFISCFKKQPYNNPKFFRRKVDLINKFIGQRLM--ETYSRNKRKHYYNND 333

Human   366 DAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLET 430
            ..|.:|:..:.::|.||                      |::.|                     
pombe   334 WQIKSAAITMALLYSAN----------------------SQMRL--------------------- 355

Human   431 ELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTCPFILNAVTKNLGLYY 495
                  :|.........:|||        :..|:..:: :..|.|.|...||:|:...|...|..
pombe   356 ------IDRSSFYCIMADFIN--------LYHDFELWE-QKINCFCFCQYPFLLSMGAKISILQL 405

Human   496 DNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFE 560
            |.|.:|..:.|.....|::....:.|||.::||||.:::|:|.::.    :...|.:|.|.|||.
pombe   406 DARRKMEIKAREAFFSSILSKMNVEPYLMIRVRRDRLLEDSLRQIN----DRNKDFRKALKVEFL 466

Human   561 GEQGVDEGGVSKEFFQLVVEEIFNPDIGMF-TYDESTKLFWFNPSSFETE-GQFTLIGIVLGLAI 623
            ||:|:|.||:.:|:..|:..::|:|:.|:| ..:||:...|||.|....| ..:.:.||::|:||
pombe   467 GEEGIDAGGLKREWLLLLTRKVFSPEFGLFVNCEESSNYLWFNYSHRSKEIDYYHMSGILMGIAI 531

Human   624 YNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLF 688
            :|:..|||..|...|:||:....:|.||.|..|.||:.||:||.:||:|::...:.|.|:...:.
pombe   532 HNSINLDVQMPRAFYKKLLQLPLSFNDLDDFQPSLYRGLKELLLFEGDVKNTYGLNFTINLKAVE 596

Human   689 GNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPE 753
            |...: :|||.|.::.:.||||||:|..|.||:||.:|:|||.||..||..|...:.:. ||:..
pombe   597 GFRTV-ELKEGGSELSVDNENRKEYVLRYVDYLLNTTVKKQFSAFFDGFMKVCGGNAIS-LFQDN 659

Human   754 EIELLICGSRN-LDFQALEETTEYDGGYTRDSV--------------------------LIREFW 791
            ||..||.||.. :|::.|:....|| .|.::::                          :|..||
pombe   660 EISKLIRGSEEVIDWELLKNVCVYD-FYDQNAISNSISESEPSMTASKYLCHSFVSKRKIILWFW 723

Human   792 EIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKE 856
            :::..::.:.::|||.|.||:||.|..|....::.|:..|||:::||.||||||.|.:.||||:|
pombe   724 DLISHYSLKMQKLFLIFVTGSDRIPATGAHNFQLRISVLGPDSDQLPISHTCFNHLCIWEYSSRE 788

Human   857 KLKERLLKAITYAKGFGM 874
            |||::|..|:....||.:
pombe   789 KLKKKLDTALLETNGFNI 806

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBE3ANP_000453.2 AZUL 29..83 CDD:318707 11/67 (16%)
HECTc 523..873 CDD:238033 138/379 (36%)
mug30NP_596534.1 HUL4 1..807 CDD:227354 237/929 (26%)
ZnF_UBP 100..152 CDD:197632 11/73 (15%)
HECTc 433..804 CDD:238033 137/378 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T999354
orthoMCL 1 0.900 OOG5_127640
Panther 1 1.100 O PTHR45622
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.