DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE3A and herc-1

DIOPT Version :8

Sequence 1:NP_000453.2 Gene:UBE3A / 7337 HGNCID:12496 Length:875 Species:Homo sapiens
Sequence 2:NP_490834.1 Gene:herc-1 / 171700 WormBaseID:WBGene00021685 Length:1019 Species:Caenorhabditis elegans

Alignment Length:967 Identity:239/968 (25%)
Similarity:372/968 (38%) Gaps:274/968 (28%)


Human    11 SGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCG--NEACTNE------FCASCPTF------- 60
            |||...||:.    .:.:.:|:     ||: :|.|  ..||.:.      .|....:|       
 Worm   219 SGELGIDDLR----PQTSVQHV-----HQM-DGLGVVEAACGDNHTVLLTHCGRTFSFGSDALGQ 273

Human    61 ------LRMDNNAAAIKAL---ELYKINAKLCDPHPSKKGASSAYLENSKGAPNN---------- 106
                  :....|..|:..|   .:.:|.|..|......|||...:..||.|...|          
 Worm   274 CGFGKKVEKRTNPTAVSDLIGSHVTRIAAGACHTIAICKGAPYPFGLNSSGQLGNGKIMTQSTPR 338

Human   107 ----------------------SCSEIKMNK-KGARIDFKDVTYLTEEKVYEILELCREREDYSP 148
                                  |...|:.|: .|.....:....|..|.:.::|    :..|...
 Worm   339 KTDELDHVTGVFAGYHQTFFVRSSGTIEQNEIVGPSCPMQYPIKLDHESLKKLL----DEGDALE 399

Human   149 LIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSR 213
            ::.:|..||||..::..||..                  |||.......|.              
 Worm   400 VMSLIESVFSSLASMNMSFLY------------------KDERRYNVGFCF-------------- 432

Human   214 IGDSSQGDNNLQKLGPDDVSVDIDAI------------RRVYTRLLSNEKIETAFLNALVYLSPN 266
              :.|.|             :|:|.:            :|.|..|:. :.::.||......|. .
 Worm   433 --ERSHG-------------IDMDQVMEAFMLFDEYPMKRQYMELIV-DSLKIAFQEWSENLK-G 480

Human   267 VEC-----DLTYHNVYSRDPNYLNLFIIVMENRNLHSPEYLEMALPLFCKAMSKLPLAAQGKLIR 326
            :||     .|.:..:::.:.|       |...:|:|:|         |..||..:....:..|.:
 Worm   481 IECLRVLLMLPWLPIFTENVN-------VQTIKNVHTP---------FVDAMCLITGDLRAALEK 529

Human   327 LWSKYNADQIRRMMETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTN 391
            .|::.:....|||:..|:                     .||.|..|.                 
 Worm   530 WWTQLSTRHFRRMVTVFK---------------------TAIKAMLKA----------------- 556

Human   392 HNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCRK--------------- 441
                                        |||||             ||.|               
 Worm   557 ----------------------------KKGPR-------------DCHKFILIMQKLSLINKTY 580

Human   442 PLIPFEEFINEPLNEVLEMDKDYTF-------FKVETENKFSFMTCPFILNAVTKNLGLYYDNRI 499
            .:||.|.|..:.||..:::..:|..       .|.|.:....|   ||:||.|.|...::.:..:
 Worm   581 HIIPLETFYIDELNTSVDLKLEYVLELTRQDPNKTELDYWTHF---PFLLNGVAKGELIFVEAWL 642

Human   500 RMYSERRITVLYSLVQGQQL--NPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGE 562
             |.:.||.:.|::...|..:  .|:|.|.|||:.|:.|.   :..:|..:.:||:|.|.|...||
 Worm   643 -MQTLRRQSSLFNTAHGTIIFELPHLELTVRREFIVSDT---MNQMAGLSESDLQKPLKVNIAGE 703

Human   563 QGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFN--PSSFETEGQFTLIGIVLGLAIYN 625
            ...|.|||.||||.||:.:|...|.|||:.||.:.|.||:  ||.|....||..:|.::||:|||
 Worm   704 DADDAGGVRKEFFILVMRKILQSDYGMFSEDEESHLVWFSGLPSEFCDREQFHQLGRLVGLSIYN 768

Human   626 NCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEY-EGNVEDDMMITFQISQTDLFG 689
            :.|:...||:.:|:.|:.......||.:..|...:.||.||.| |.:|||...:.|.|| .::.|
 Worm   769 HSIVPFPFPLALYKYLLDTPPDLEDLCELSPSEGKGLKMLLSYEEDDVEDVFGLNFCIS-FNILG 832

Human   690 NPMMYDLKENGDKIPITNENRKEFVNLYSDYIL----NKSVEKQFKAFRRGFHMVTNESPLKYLF 750
            .....:|...|.:.|:||.||.|:|.||..:.|    |..:.:|...||:||....:...|:: |
 Worm   833 ETHTTELLSGGTEKPVTNANRDEYVRLYVHHRLELGYNGEIAQQALLFRKGFSESLHSRTLRF-F 896

Human   751 RPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRA 815
            :|.|::.:|.|:.|.|:....:...|.|.|:.....|:.||:...:.||:::|.||||.||:.|.
 Worm   897 QPCELKEMIVGNENYDWNEFRDILMYRGEYSSSHPTIQAFWKAFFALTDDERRKFLQFLTGSTRI 961

Human   816 PVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGF 872
            ||.|..:|...|..:.|  |.||.:|||||:|.||..:...:|..||..:|.:.:||
 Worm   962 PVSGWEELHAAIQPSAP--ESLPVAHTCFNLLDLPNIADDVELLRRLRISIEHTEGF 1016

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBE3ANP_000453.2 AZUL 29..83 CDD:318707 14/78 (18%)
HECTc 523..873 CDD:238033 132/358 (37%)
herc-1NP_490834.1 RCC1 7..56 CDD:278826
RCC1_2 43..72 CDD:290274
RCC1 59..109 CDD:278826
RCC1_2 96..125 CDD:290274
RCC1 112..160 CDD:278826
RCC1_2 147..176 CDD:290274
RCC1_2 192..220 CDD:290274 1/1 (100%)
RCC1 208..257 CDD:278826 12/48 (25%)
RCC1 261..310 CDD:278826 7/49 (14%)
RCC1 316..359 CDD:278826 4/43 (9%)
HECTc 667..1016 CDD:238033 131/356 (37%)
HECTc 691..1016 CDD:214523 123/329 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276447at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.