DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: U2AF1 and U2af38

Sequence 1:NP_001020374.1 Gene:U2AF1 HGNCID:12453 Length:240 Species:Homo sapiens
Sequence 2:NP_001259814.1 Gene:U2af38 FlyBaseID:FBgn0017457 Length:264 Species:Drosophila melanogaster

Alignment Length:254 Identity:190/255 (75%)
Similarity:206/255 (81%) Gaps:17/255 (7%)


Human     1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQTADGS 65
            |||||||||||||||||||||||||||||||||||:|||||||||:|:||:|.||||||::||||
  Fly     1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQNLYVNPQNSAKSADGS 65

Human    66 HCA--VSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVI 128
            |..  |||.|||||||.|||:||.|.|:||||:||||||||||||||||||:|||.|.|||||..
  Fly    66 HLVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRNEADAEKAAN 130

Human   129 DLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRELRRELYGRRRKKH 193
            |||||||.|:|:::|||||||||||||||||||||||.|||||||||||||||||.||.|||:. 
  Fly   131 DLNNRWFGGRPVYSELSPVTDFREACCRQYEMGECTRSGFCNFMHLKPISRELRRYLYSRRRRA- 194

Human   194 RSRSRS----RERRSRSRDRGRGGGGGGGGGGGG----------RERDRRRSRDRERSG 238
            ||||||    |..|||||..||.|||.|.|.|||          |..||...|||.:.|
  Fly   195 RSRSRSPGRRRGSRSRSRSPGRRGGGRGDGVGGGNYLNNERDNMRGNDRGNDRDRRKGG 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
U2AF1NP_001020374.1 zf-CCCH 13..39 CDD:279036 25/26 (96%)
RRM_U2AF35 43..146 CDD:240982 78/105 (74%)
zf-CCCH 149..175 CDD:279036 25/26 (96%)
U2af38NP_001259814.1 zf-CCCH 13..39 CDD:279036 25/26 (96%)
RRM_U2AF35 43..148 CDD:240982 78/105 (74%)
zf-CCCH 151..177 CDD:279036 25/26 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17908225
eggNOG 1 0.900 E1_KOG2202
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1692
OMA 1 1.010
OrthoDB 1 1.010 D1340384at2759
OrthoFinder 1 1.000 FOG0002828
OrthoInspector 1 1.000 T609450
orthoMCL 1 0.900 OOG5_127450
Panther 1 1.100 LDO PTHR12620
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.