DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: C5 and Tep2

Sequence 1:NP_001304092.1 Gene:C5 HGNCID:1331 Length:1682 Species:Homo sapiens
Sequence 2:NP_523506.1 Gene:Tep2 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster

Alignment Length:1627 Identity:380/1628 (23%)
Similarity:671/1628 (41%) Gaps:349/1628 (21%)


Human    29 YVISAPKIFRVGASENIVIQVYGYTEAFDATISIK--SYPDKKFSYSSGHVHL---SSEN-KFQN 87
            |.:..|...|..:..|:|:.|:.........:|:.  ||.:.|      .:.|   |::| :|: 
  Fly    23 YSVVGPGTLRSNSKYNVVVSVHKADGPSQIKVSLNGPSYNETK------QIELPPMSTQNVEFE- 80

Human    88 SAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPDQSVKVRVY 152
                  .||...|..|..:.....||   |..|.::........:|:.|||..|.|...|:.|:.
  Fly    81 ------VPKLATGNYNLSAEGVSGVV---FKNSTKLNYADKKPSVFVQTDKATYKPADLVQFRIL 136

Human   153 SLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHI----GIISFPDFKIPSNPRYGMWTIKAKYKE 213
            .|:::.:|||.|..::.|..:|:: :.::::..:    |:.| .:.::...|..|.|.|....  
  Fly   137 FLDENTRPAKIEKPISVIIIDGAQ-NRIKQLSDVKLTKGVFS-GELQLSEQPVLGTWKISVSV-- 197

Human   214 DFSTTGTAYFEVKEYVLPHFSVSIE-PEYNFIGYKNFKNFEITIKARYFYNKVVT-EADVYI--T 274
            |.....|..|||.:||||.|.|.:: |:...|..|..|   .||:|:|.|.|.|. :|.|.:  :
  Fly   198 DGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIK---ATIRAKYTYGKPVKGKATVSMERS 259

Human   275 FGIREDLKDDQKEMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDLNNKYL----YIAVTV 335
            :|...||..:..:     .:.|:.::|...|.||       :.:::   ...:||    ..||..
  Fly   260 YGYFGDLNANGNK-----QEKTIDVDGKGHVEFD-------IIHWA---QRGQYLPPIKLFAVVT 309

Human   336 IESTGGFSEEAEIPGI----KYVLSPYKLNLVATPLFLKPGIPYPIKVQVKDSLDQLVGGVPVTL 396
            .|.||. .:.|....:    :|.:.||:     .|...:....:..:|.||:     |.|.|||.
  Fly   310 EELTGN-KQNATATVVLHQQRYSIEPYE-----RPEHFEANKSFIYQVVVKN-----VDGSPVTN 363

Human   397 NAQTIDVNQETSDL---DPSKSVTRV-------DDGVASFVLNLPSGVTVLEFNVKTDAPDLPEE 451
            :|:.:.:..:.|..   :||.. ||:       ::|:|:|.:.||                   :
  Fly   364 SAKNVKIGFDKSYSYFHEPSPK-TRINFEAPVNENGIATFNVRLP-------------------D 408

Human   452 NQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVG------------EHLNIIVTPKSP------- 497
            :.:|. ||..|         ..|.::|    .:|            |.|.|.|..|.|       
  Fly   409 SDSRY-YRIFA---------SFDGSEN----TIGSISKFEPTPMSREPLKIQVNTKKPRLGEQVS 459

Human   498 ----YIDKITHYNYLILSKGKIIHFGTREKFSD--------ASYQSINIPVTQNMVPSSRLLVYY 550
                .|:.:.::.|.|:::|.:|       .||        .:| ::....|.:|||.:.:.|||
  Fly   460 FDVVSIEDLPYFVYTIVARGNVI-------LSDYVDVPDGQKTY-TVKFTPTFSMVPKATIYVYY 516

Human   551 IVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWVALAAVDSAV 615
            :|..    :|..:...::.|::..|.:.|....:|   .|.:.|.|.:.|..||:|.|..||.:|
  Fly   517 VVNN----DLQFEEKTIDFEKEFSNSIDVSAPTNA---KPSEEVKLRIKTDADSFVGLLGVDQSV 574

Human   616 YGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVF---------------HLAGLTFLTNANA 665
            ..::.|.....:.:|                |:.|::               ..:||..||||| 
  Fly   575 LLLKSGNDLSQDDIF----------------NSLNIYQTSTPWMNGYGRYPGQTSGLVTLTNAN- 622

Human   666 DDSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISL---- 726
                          .|..|....:..:....:|..:.:..|                |:.:    
  Fly   623 --------------YPYNTGPLVMSYVFEGSRHPWITRPRY----------------RVGIRGDS 657

Human   727 GPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPE---IRSYFPESWLWEVHLVPR 788
            |.|                  ||.....|...::|.:|....|:   ||..|||:|.:| ::...
  Fly   658 GDR------------------ISFLSQSLNDRNLKEILLKQTPQRTTIRKEFPETWFFE-NVGEE 703

Human   789 RKQLQFALPDSLTTWEIQGVGISNT-GICVA-DTVKAKVFKDVFLEMNIPYSVVRGEQIQLKGTV 851
            ...|...:||::|:|.:.|..::.| ||.:. :..|.:||:..|:..|:||||.|||.|.:...:
  Fly   704 EFTLTKKIPDTITSWVVTGFSLNPTSGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVI 768

Human   852 YNYRTSGMQFCVKMSAVE---GICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTVLPLEIGL 913
            :||....:...|.|...:   ....:.:.|::....:..:..|..:..:|...|:|.:.|..:|.
  Fly   769 FNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKRVTIPANSGKSVSFMIRPKNVGF 833

Human   914 HNINFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFPYR----IPLDLV 974
            ..:..:..:....:.:.:.|:|.||||       ...:.|.::..:..:.|....    ||.::|
  Fly   834 TTLKITATSALAGDAIHQKLKVEPEGV-------TLFENRAVFINLKDQPEMSQSLDADIPNEVV 891

Human   975 PKTEIKRILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFYVFHYLE-TGNHWN 1038
            |::|.     ::..:||::|...|  :.::.|..:|.|..|..:::.||...|..||| ||... 
  Fly   892 PQSEF-----IEFSVVGDLLGPTL--QNLDNLVRMPYGCGEQNMVNFVPNILVLKYLEVTGRKL- 948

Human  1039 IFHSDPLIEKQKLKKKLKEGMLSIMSYRNADYSYSVW--KGGSASTWLTAFALRVLGQVNKYVEQ 1101
                 |.:| .|.:|.|:.|....::|::.|.|||.:  ...|.||||||:.:|...|...|.:.
  Fly   949 -----PSVE-SKARKFLEIGYQRELTYKHDDGSYSAFGKSDASGSTWLTAYVMRSFHQAGTYTDI 1007

Human  1102 NQNSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFDICP 1166
            :...|...|.:||.. |.::|.|.|         .|.|...|.:|.|.||:|.::...:..::.|
  Fly  1008 DPKVITAGLDFLVSK-QKESGEFPE---------VGKLFDNANQNPLALTSFVLLAFFENHELIP 1062

Human  1167 LVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDKTHPQFRSIVSALKREALVKGNPPIY 1231
              |..:|:.||..::.|........::|||:|.||.|.  .|||...:::.|:..|..:.:    
  Fly  1063 --KYQSAIKKAVRYVAEEADKTDDQYSLAIAAVALQLA--KHPQSEKVIAKLESVARKEND---- 1119

Human  1232 RFWKDNLQHKDSSVPNTG----------TARMVETTAYALLTSLNLKDINYVNPVIKWLSEEQRY 1286
            |.|      ...:..:||          .:..||.|:|.||..|.........|:||||..::..
  Fly  1120 RMW------WSKATESTGEDGRVFHWKPRSNDVEITSYVLLALLEKDPAEKALPIIKWLISQRNS 1178

Human  1287 GGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDD 1351
            .|||.|||||:..::.||:::........:|||:.|...: :.:..|:..:|.|     ||...|
  Fly  1179 NGGFSSTQDTVIGLQALTKFAYKTGSGSGTMDIEFSSAGE-SKNTIKVNPENSL-----VLQTHD 1237

Human  1352 LIVS------TGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVA 1410
            |..|      |..|:|.|.|.: :..:..:..|:..||.:....:|..         :....:..
  Fly  1238 LPKSTRKVDFTAKGTGSAMVQL-SYRYNLAEKEKKPSFKVTPTVKDTP---------NQLLIVDV 1292

Human  1411 CASYKPSRE-ESSSGSSHAVMDISLPTGISANEEDLKALVEGVDQL-FTDYQIKDGHVILQLNSI 1473
            ||.|.|..: :....|:.|||:|:||:|...:...| ..::.||:: ..:.:..|..|::..:|:
  Fly  1293 CAEYVPLEDADKDKDSNMAVMEIALPSGFVGDSTSL-GKIQAVDRVKRVETKNSDSTVVVYFDSL 1356

Human  1474 PSSDFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQKVCEGAACKCVEADC 1538
            ...|..|:.....:...|....||:.::|:|:..:::.|.:|...: .:..:|||       |||
  Fly  1357 TPGDVRCLPLEASKAHAVAKQKPASVSLYDYYDTERKATEYYQVKS-SLCDICEG-------ADC 1413

Human  1539 GQ 1540
            |:
  Fly  1414 GE 1415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
C5NP_001304092.1 A2M_N 132..225 CDD:280081 25/97 (26%)
A2M_N_2 478..616 CDD:285005 40/169 (24%)
ANATO 688..756 CDD:237984 8/72 (11%)
A2M 778..865 CDD:278630 27/89 (30%)
complement_C3_C4_C5 999..1306 CDD:239226 93/320 (29%)
A2M_comp 1057..1307 CDD:284982 76/262 (29%)
A2M_recep 1427..1515 CDD:284981 21/89 (24%)
NTR_complement_C5 1533..1682 CDD:239637 4/9 (44%)
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 25/98 (26%)
A2M_N_2 445..576 CDD:285005 36/146 (25%)
A2M 694..782 CDD:278630 27/89 (30%)
A2M_2 909..1198 CDD:239227 94/322 (29%)
A2M_comp 961..1199 CDD:284982 76/262 (29%)
A2M_recep 1308..1398 CDD:284981 22/91 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120042901
eggNOG 1 0.900 E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177369at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11412
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.