DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: C4B and Tep2

Sequence 1:NP_001002029.3 Gene:C4B HGNCID:1324 Length:1744 Species:Homo sapiens
Sequence 2:NP_523506.1 Gene:Tep2 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster

Alignment Length:1566 Identity:383/1567 (24%)
Similarity:656/1567 (42%) Gaps:360/1567 (23%)


Human   132 LLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPS--TDTITVMVENSHGLRVRK-KEVYM 193
            |.::.::..:|:|||:..|.|...|::|:..||:..||:  ...|:|::.:....|::: .:|.:
  Fly   107 LNYADKKPSVFVQTDKATYKPADLVQFRILFLDENTRPAKIEKPISVIIIDGAQNRIKQLSDVKL 171

Human   194 PSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPNFEVKITPGKPYILTVPGH 258
            ...:|..:..:.:....||||||... || ::..:..|||.|||||.|||.:...|..::.    
  Fly   172 TKGVFSGELQLSEQPVLGTWKISVSV-DG-DNRETKSFEVDKYVLPKFEVIVDTPKAVVIA---- 230

Human   259 LDE-MQLDIQARYIYGKPVQGVA-------YVRFGLLDEDGKKTFFRGLESQTKLVNGQSHISLS 315
             |: ::..|:|:|.|||||:|.|       |..||.|:.:|.|      :.:|..|:|:.|:   
  Fly   231 -DKVIKATIRAKYTYGKPVKGKATVSMERSYGYFGDLNANGNK------QEKTIDVDGKGHV--- 285

Human   316 KAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSWYFVSSPFSLDLSKTKRHLVP 380
              || |.:.....| ..|..::|:  |.:.|...|..:.|..|. ......:|::..:...|...
  Fly   286 --EF-DIIHWAQRG-QYLPPIKLF--AVVTEELTGNKQNATATV-VLHQQRYSIEPYERPEHFEA 343

Human   381 GAPFLLQALVREMSGSPA--SGIPVKVSATVS-----SPGSVPEVQDIQQNTDGSGQVSIPIIIP 438
            ...|:.|.:|:.:.|||.  |...||:....|     .|.....: :.:...:.:|..:..:.:|
  Fly   344 NKSFIYQVVVKNVDGSPVTNSAKNVKIGFDKSYSYFHEPSPKTRI-NFEAPVNENGIATFNVRLP 407

Human   439 QTISE-LQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDSRPPRVGDTLNLNLRAVGSGATF 502
            .:.|. .::..|.......|..::...|.......|.|: .:::.||:|:.::.::.::   ...
  Fly   408 DSDSRYYRIFASFDGSENTIGSISKFEPTPMSREPLKIQ-VNTKKPRLGEQVSFDVVSI---EDL 468

Human   503 SHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPSFYFVAF--------------YYHGDHP 553
            .::.|.|::||.::            :|.:||.......|.|.|              ||    .
  Fly   469 PYFVYTIVARGNVI------------LSDYVDVPDGQKTYTVKFTPTFSMVPKATIYVYY----V 517

Human   554 VANSLRVDVQAGACEGKLELSVDGAKQYRN------------GESVKLHLETDSLALVALGALDT 606
            |.|.|:.:          |.::|..|::.|            .|.|||.::||:.:.|.|..:|.
  Fly   518 VNNDLQFE----------EKTIDFEKEFSNSIDVSAPTNAKPSEEVKLRIKTDADSFVGLLGVDQ 572

Human   607 ALYAAGSKSHKPLNMGKVFEAMNSYDL------GCG--PGGGDSALQVFQAAGLAFSDGDQWTLS 663
            ::...  ||...|:...:|.::|.|..      |.|  ||         |.:||.       ||:
  Fly   573 SVLLL--KSGNDLSQDDIFNSLNIYQTSTPWMNGYGRYPG---------QTSGLV-------TLT 619

Human   664 RKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDC 728
                            |.|           |...|.           |::.|.....:       
  Fly   620 ----------------NAN-----------YPYNTG-----------PLVMSYVFEGS------- 639

Human   729 REPFLSCCQFAESLRKKSRDK----GQAGLQRAL-EILQEEDLIDEDDIPVRSFFPENWLWRVET 788
            |.|:::..::...:|..|.|:    .|:...|.| |||.::   ......:|..|||.|.:....
  Fly   640 RHPWITRPRYRVGIRGDSGDRISFLSQSLNDRNLKEILLKQ---TPQRTTIRKEFPETWFFENVG 701

Human   789 VDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVA-TPVQLRVFREFHLHLRLPMSVRRFEQLELR 852
            .:.| .||..:||::|:|.:.|.||:.|.|:.:. .|.::|||:.|.:...||.||:|.|.:.:.
  Fly   702 EEEF-TLTKKIPDTITSWVVTGFSLNPTSGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIP 765

Human   853 PVLYNYLDKNLTVSV---------------------HVSPVEGLCLAGGGGLAQQVLVPAGSARP 896
            .|::|||||.|...|                     .:..|..:         ::|.:||.|.:.
  Fly   766 VVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRV---------KRVTIPANSGKS 821

Human   897 VAFSVVPTAATAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIP 961
            |:|.:.|......:||:.|..:.   .|||:.:.|::|.||....|.....:|..|....:..:.
  Fly   822 VSFMIRPKNVGFTTLKITATSAL---AGDAIHQKLKVEPEGVTLFENRAVFINLKDQPEMSQSLD 883

Human   962 GNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASR 1026
            .:....::|..:|..:..|.     |.||.    :...:.:|:|:|.|||||.|:...|.:...:
  Fly   884 ADIPNEVVPQSEFIEFSVVG-----DLLGP----TLQNLDNLVRMPYGCGEQNMVNFVPNILVLK 939

Human  1027 YLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAW--LSRGSSTWLTAFVLKVLSLA 1089
            ||:.|   ....|..:..|...::.||.|...::..||||:|:  .....||||||:|::....|
  Fly   940 YLEVT---GRKLPSVESKARKFLEIGYQRELTYKHDDGSYSAFGKSDASGSTWLTAYVMRSFHQA 1001

Human  1090 QEQVGGSPEKLQETSNWLLSQQQADGSFQDLSPVIHRSMQGGLVGNDETVALTAFVTIALHHGLA 1154
            .......|:.:....::|:|:|:..|.|.::..:...:       |...:|||:||.      ||
  Fly  1002 GTYTDIDPKVITAGLDFLVSKQKESGEFPEVGKLFDNA-------NQNPLALTSFVL------LA 1053

Human  1155 VFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYALTLTKAPADLRGVAHNNLMA 1219
            .|::....|   :.:::|.||..::.|:|.. ....::.||.|.||.|.|.|...:.:|  .|.:
  Fly  1054 FFENHELIP---KYQSAIKKAVRYVAEEADK-TDDQYSLAIAAVALQLAKHPQSEKVIA--KLES 1112

Human  1220 MAQETGDNLYWGSV---TGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEM 1281
            :|::..|.::|...   ||.........|...:            :|.|:|.|| .||.:..||.
  Fly  1113 VARKENDRMWWSKATESTGEDGRVFHWKPRSND------------VEITSYVLL-ALLEKDPAEK 1164

Human  1282 ADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERG-LNVTLSSTGRNGFKSHALQ 1345
            |.....||..|.:..|||.|||||||.|.||:.:  |..|....| :::..||.|.         
  Fly  1165 ALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKF--AYKTGSGSGTMDIEFSSAGE--------- 1218

Human  1346 LNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYT 1410
                              ||..:||  |.:.:| ||:|:   |:..:|   .:::.|.||.....
  Fly  1219 ------------------SKNTIKV--NPENSL-VLQTH---DLPKST---RKVDFTAKGTGSAM 1256

Human  1411 MEANEDYEDYEYDELPA-------KDDPDAPL-----QPVTPLQLFEGRRNRRRREAPKVVEEQE 1463
            ::.:..|...|.::.|:       ||.|:..|     ....||:           :|.|..:   
  Fly  1257 VQLSYRYNLAEKEKKPSFKVTPTVKDTPNQLLIVDVCAEYVPLE-----------DADKDKD--- 1307

Human  1464 SRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPH--VLLYF 1526
                             |.||:.::.|.|||......|.|:.:: || |...||:...  |::||
  Fly  1308 -----------------SNMAVMEIALPSGFVGDSTSLGKIQAV-DR-VKRVETKNSDSTVVVYF 1353

Human  1527 DSV-PTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQ- 1589
            ||: |....|:..||.:...|...:|||.:|||||:.||:.:.:|      ::.::||  ::|: 
  Fly  1354 DSLTPGDVRCLPLEASKAHAVAKQKPASVSLYDYYDTERKATEYY------QVKSSLC--DICEG 1410

Human  1590 --CAEG 1593
              |.||
  Fly  1411 ADCGEG 1416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
C4BNP_001002029.3 A2M_N 141..233 CDD:280081 27/95 (28%)
A2M_N_2 478..610 CDD:285005 31/158 (20%)
ANATO 686..750 CDD:237984 9/68 (13%)
A2M 782..869 CDD:278630 32/109 (29%)
complement_C3_C4_C5 996..1315 CDD:239226 94/324 (29%)
A2M_comp 1051..1317 CDD:284982 79/271 (29%)
A2M_recep 1481..1570 CDD:284981 34/92 (37%)
NTR_complement_C4 1588..1742 CDD:239639 4/10 (40%)
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 27/96 (28%)
A2M_N_2 445..576 CDD:285005 32/161 (20%)
A2M 694..782 CDD:278630 32/89 (36%)
A2M_2 909..1198 CDD:239227 94/324 (29%)
A2M_comp 961..1199 CDD:284982 79/272 (29%)
A2M_recep 1308..1398 CDD:284981 34/92 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177369at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11412
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.