DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HSP90B1 and Hsp83

Sequence 1:NP_003290.1 Gene:HSP90B1 HGNCID:12028 Length:803 Species:Homo sapiens
Sequence 2:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster

Alignment Length:732 Identity:353/733 (48%)
Similarity:485/733 (66%) Gaps:36/733 (5%)


Human    71 EKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVK 135
            |::|.||||||:.::|.||||:.|.|||||||||||||||||||||..||||.:.|...:||.:|
  Fly     3 EEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIK 67

Human   136 IKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFY 200
            :..:|....|.:.|||:|||:.:||.||||||||||..|:    ||.:.|...| :|||||||||
  Fly    68 LIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFM----EALQAGADIS-MIGQFGVGFY 127

Human   201 SAFLVADKVIVTSKHNNDTQHIWESDS-NEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTI 264
            ||:||||||.||||:|:|.|::|||.: ..|:|.|| ....|||||.|.|.:||:.:||||...|
  Fly   128 SAYLVADKVTVTSKNNDDEQYVWESSAGGSFTVRAD-NSEPLGRGTKIVLYIKEDQTDYLEESKI 191

Human   265 KNLVKKYSQFINFPIYVWSSKTETVE----EPMEEEEAAKEEKEESDDEAAV----EEEEEEKKP 321
            |.:|.|:||||.:||.:...|....|    |..:|::...|:||...||..:    |:|:.:||.
  Fly   192 KEIVNKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADKKD 256

Human   322 KTKKVEKTV----WDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVT 382
            |..|.:||:    .:.|.:|..||||.|...::.::||..||||.:.:.:|.:|..||:.||::.
  Fly   257 KDAKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLE 321

Human   383 FKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVS 447
            |:::||:|...|..||:  ..||.:.||||||||||.|:..|::|:||||:||||||:|||||:|
  Fly   322 FRALLFIPRRTPFDLFE--NQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNIS 384

Human   448 RETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYN-DTFWKEFGTNIKLGVIEDHSNRTRLAKLLR 511
            ||.|||:|:||||||.||:||:::|:::.:||.| ..|:.:|..|:||||.||.:||.:||..||
  Fly   385 REMLQQNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLR 449

Human   512 FQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYC 576
            |.:|....|..||..||.|||:.|..:||:.|.|:.:..:|.||||:..:|:||:|:|||:|||.
  Fly   450 FHTSASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYV 514

Human   577 IQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLT 641
            ||.|.|:.||:..:|.|||::..|.|..|:.||..:.:||.|...|| ..|.:|:||.|||.||.
  Fly   515 IQHLKEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMK-SILDNKVEKVVVSNRLV 578

Human   642 ESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDED 706
            :|||.:|.||:|||.||||||||||.   :|.:|..|.:.||..||||.||::..:.::...|::
  Fly   579 DSPCCIVTSQFGWSANMERIMKAQAL---RDTATMGYMAGKKQLEINPDHPIVETLRQKADADKN 640

Human   707 DKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEP-EEEPEETAEDT 770
            ||.|.||.::||||:.|.||:.|...:.:..||.||::|.|.||     |:|| ..:..::|.|.
  Fly   641 DKAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGID-----EDEPMTTDDAQSAGDA 700

Human   771 TEDTEQDED----EEMD 783
            ....|..||    ||:|
  Fly   701 PSLVEDTEDASHMEEVD 717

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HSP90B1NP_003290.1 HSP90 77..>464 CDD:332554 205/400 (51%)
HSP90 257..755 CDD:306652 234/511 (46%)
Prevents secretion from ER 800..803
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 351/728 (48%)
HATPase_c 28..179 CDD:214643 92/157 (59%)
HSP90 184..706 CDD:278607 240/533 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0326
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174605at33208
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126623
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.