DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1R and Jon99Fi

DIOPT Version :9

Sequence 1:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:103/270 - (38%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   468 PVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRG----GGALLGDRWILTAAHTLYPKEHEAQSN 528
            ||..|:.:.||..|..|..|..|:.|.....|.|    ||:::|:.|:|||||.         :|
  Fly    28 PVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHC---------TN 83

Human   529 ASLDVFLGHTNVEELMKLGNHPIRRVSV-------HPDYRQDESYNFEGDIALL--------ELE 578
            .:..|.:.:.     ..|.|.|.....|       |..|   .|.|...||:|:        .|.
  Fly    84 GASGVTINYG-----ASLRNQPQYTHWVGSGNFVQHHHY---NSGNLHNDISLIRTPHVDFWHLV 140

Human   579 NSVTLGPNLLPICLPDNDTFYD-LGLMGYVSGFGVMEE--KIAHDLRFVRLPVANPQACENWLRG 640
            |.|.| |:.       ||.:.| .|.....||:|...:  .:...|:.|.:.:.:...|      
  Fly   141 NKVEL-PSY-------NDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDC------ 191

Human   641 KNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSW--GIGCSRGY-GFYT 702
             :|......||.|......| ..|.|||||.....:.|.    ..|:.|:  ..||..|. ..::
  Fly   192 -SRTWSLHDNMICINTNGGK-STCGGDSGGPLVTHEGNR----LVGVTSFVSSAGCQSGAPAVFS 250

Human   703 KVLNYVDWIK 712
            :|..|:|||:
  Fly   251 RVTGYLDWIR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569
Sushi 390..461 CDD:306569
Tryp_SPc 477..711 CDD:214473 66/258 (26%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 66/258 (26%)
Tryp_SPc 38..262 CDD:238113 67/260 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.