DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1R and CG9733

DIOPT Version :9

Sequence 1:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:416 Identity:110/416 - (26%)
Similarity:151/416 - (36%) Gaps:107/416 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   337 NLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDF 401
            |.||      |...|...||..|:...  .:|.......|.|....|:..:....:.|....|:.
  Fly    71 NNQP------YVCC
TQDTGYVRIQRQD--RTFPDYGAFGGDWEEERPQSFVFPRQERRPWSFGNQ 127

Human   402 RYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSRESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCG 466
            ..|:               ..|:.|..|..||....|.                       |.||
  Fly   128 PATS---------------RTPFRKSSTSDGSSLLPQP-----------------------PSCG 154

Human   467 KPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRGG--------GALLGDRWILTAAHTLYPKEH 523
                .|..|.||..||...:..|||.|......|.|        |:|:..|::|||||.|..: .
  Fly   155 ----GVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGR-I 214

Human   524 EAQSNASLDVFLG----HTNVE----------ELMKLGNHPIRRVSVHPDYRQDESYNFEGDIAL 574
            |.:....:.|.||    .|.|:          |:.:||...||   ||..|.:..| |...||.|
  Fly   215 EREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIR---VHERYSEKAS-NQVHDIGL 275

Human   575 LELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPV--------ANP 631
            :.:|.:|....|:.|||||.:     :||....||...........|:..|..|        .:|
  Fly   276 IRMERNVRYSDNIQPICLPSS-----VGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTVNYVDP 335

Human   632 QACENWLRGKNRMDVFSQNM----FCAGHPSLKQDACQGDSGG-VFAVRDPNTDRWVATGIVSWG 691
            ..|      :.|......|:    .||| ...::|:|.||||| :...||   :.||..||||:|
  Fly   336 AKC------RQRFSQIKVNLEPTQLCAG-GQFRKDSCDGDSGGPLMRFRD---ESWVLEGIVSFG 390

Human   692 IGCS-RGY-GFYTKVLNYVDWIKKEM 715
            ..|. :.: |.||.|..|..||::.:
  Fly   391 YKCGLKDWPGVYTNVAAYDIWIRQNV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569 12/47 (26%)
Sushi 390..461 CDD:306569 9/70 (13%)
Tryp_SPc 477..711 CDD:214473 82/270 (30%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855 4/12 (33%)
Tryp_SPc 161..412 CDD:214473 82/270 (30%)
Tryp_SPc 162..415 CDD:238113 83/272 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.