DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1R and CG9737

DIOPT Version :9

Sequence 1:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:432 Identity:119/432 - (27%)
Similarity:175/432 - (40%) Gaps:111/432 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   376 GTWHRAMPRCKI-KDCGQPRNLPNGDFRYTTTMGVNTYKARIQY--YCHEP------YYKMQTRA 431
            |.::|.:...:: ::|..|.....|     ..:.|:..||.:|.  ..:.|      ..|:|...
  Fly    13 GCFYRFLALAEVLQECDIPNETKRG-----VCLEVSRCKAYLQVRNATNLPAEKVNFLKKVQCEV 72

Human   432 GSRESE-QGVY----TCTAQG---------IWKNEQ----------KGEKIPR------------ 460
            ..:.|| ||.|    .|.|.|         ..|.|.          |.:|:.|            
  Fly    73 EQQVSEAQGSYESLVCCPANGQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSGFN 137

Human   461 CLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVF----TNIHGRGGGALLGDRWILTAAHTLYPK 521
            .|..|||.|.     .||.||:.|::..|||...    :|.:| ..|||:.||.||||||.:   
  Fly   138 LLNECGKQVT-----NRIYGGEIAELDEFPWLALLVYNSNDYG-CSGALIDDRHILTAAHCV--- 193

Human   522 EHEAQSNASLD------VFLGHTNVE---ELMKLGNH----------PIRRVSVHPDYRQDESYN 567
                |.....|      |.||..||:   :.::..|:          ...::.|||:|::..:|.
  Fly   194 ----QGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYK 254

Human   568 FEGDIALLELENSVTLGPNLLPICLPDNDTFYDL--GLMGYVSGFGVME------EKIAHDLRF- 623
            : .|||::.|::.|:....::|||||:......|  |.|..|||:|..:      ..|...::. 
  Fly   255 Y-NDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLK 318

Human   624 VRLPVANPQACENWLRGKN-RMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGI 687
            :|:|..:.:.|...|.|.. |:   .....|||....| |.|.|||||.....|....||||.|:
  Fly   319 LRIPYVSNENCTKILEGFGVRL---GPKQICAGGEFAK-DTCAGDSGGPLMYFDRQHSRWVAYGV 379

Human   688 VSWGI---GCSRGYGFYTKVLNYVDWI-------KKEMEEED 719
            ||:|.   |.:.....||.|..|.|||       ||..:.:|
  Fly   380 VSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQRKKSQQTQD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569 2/8 (25%)
Sushi 390..461 CDD:306569 23/114 (20%)
Tryp_SPc 477..711 CDD:214473 84/269 (31%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855 15/65 (23%)
Tryp_SPc 149..406 CDD:214473 84/269 (31%)
Tryp_SPc 150..409 CDD:238113 85/271 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.