DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1R and CG31266

DIOPT Version :9

Sequence 1:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:283 Identity:78/283 - (27%)
Similarity:123/283 - (43%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   454 KGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPW----QVFTNIHGRGGGALLGDRWILTA 514
            :||.:|....:..........:.|:|||..|..||:||    |...:.| ..|..:|.:.|:|||
  Fly    28 RGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYH-LCGAIILDETWVLTA 91

Human   515 AHT---LYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLE 576
            |..   |.|        .:|.|..|..:..:|. ...:.:.::.||.::.:...:|   |||||:
  Fly    92 ASCVAGLRP--------LNLLVVTGTVDWWDLY-APYYTVSQIHVHCNFDKPLYHN---DIALLQ 144

Human   577 LENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVR------LPVANPQACE 635
            |.:.:........|.|.|.|...:...:.: :|:|..|....:. |:::      |||   .||.
  Fly   145 LSSKIEFNDVTKNITLADIDELEEGDKLTF-AGWGSSEAMGTYG-RYLQEASGTYLPV---DACR 204

Human   636 NWLRGKNRMDVFSQNMFCAGHPSLKQD----ACQGDSGGVFAVRDPNTD---RWVATGIVSWGIG 693
            ..|:.::.:|:        ||..::.|    ||.||:||      |..|   |.|  ||.:||:.
  Fly   205 EKLQNQDDVDL--------GHVCVQMDAGQGACHGDTGG------PLIDEQQRLV--GIGNWGVP 253

Human   694 CSRGY-GFYTKVLNYVDWIKKEM 715
            |.||| ..|.:...|.|||:..|
  Fly   254 CGRGYPDVYARTAFYHDWIRTTM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569
Sushi 390..461 CDD:306569 3/6 (50%)
Tryp_SPc 477..711 CDD:214473 72/254 (28%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 72/254 (28%)
Tryp_SPc 52..275 CDD:238113 73/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.