DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1R and Sp7

DIOPT Version :9

Sequence 1:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:424 Identity:113/424 - (26%)
Similarity:162/424 - (38%) Gaps:101/424 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   332 FTIIQNLQPQYQFRDYFIATCKQGYQL-IEGNQVLHSF---TAVCQDDGTWHRAMPRCKIKDCGQ 392
            ||::||:..|...|:   ...|||..| |...|.|.|.   :.|..:|.|:.|.      ..|  
  Fly    19 FTVLQNVAAQGSCRN---PNQKQGQCLSIYDCQSLLSVIQQSYVSPEDRTFLRN------SQC-- 72

Human   393 PRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSRESEQGVYTCTAQGIWKNEQKGEK 457
                         ..||    .|..|.|    .......||:|:.......|........|.|:.
  Fly    73 -------------LDGV----GRQPYVC----CTSDRSFGSQEATSAAPPPTTTSSSSRGQDGQA 116

Human   458 -----IPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTN-IHGRG------GGALLGDRW 510
                 :| ..|.||    |.....::..|....:..|.|..... :..||      ||:|:.:|:
  Fly   117 GLGNLLP-SPPKCG----PHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRY 176

Human   511 ILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLG---------------NHP-----IRRVS 555
            :|||||.:.         .:::..:||...   ::||               |.|     |.:.:
  Fly   177 VLTAAHCVI---------GAVETEVGHLTT---VRLGEYDTSKDVDCIDDICNQPILQLGIEQAT 229

Human   556 VHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDT--FYDLGLMGYVSGFG----VME 614
            |||.| ...:.|...|||||.|:..|.|...:.|:|||...|  ..:.|.:..|||:|    ..:
  Fly   230 VHPQY-DPANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARK 293

Human   615 EKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNT 679
            ..|...|   .|||.:...|......:|...:.||  .|.| ....:|:|.|||||.. :|....
  Fly   294 STIKQRL---DLPVNDHDYCARKFATRNIHLISSQ--LCVG-GEFYRDSCDGDSGGPL-MRRGFD 351

Human   680 DRWVATGIVSWGIGCS-RGY-GFYTKVLNYVDWI 711
            ..|...|:||:|..|. .|: |.||:|.:|:|||
  Fly   352 QAWYQEGVVSFGNRCGLEGWPGVYTRVADYMDWI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569 18/56 (32%)
Sushi 390..461 CDD:306569 13/75 (17%)
Tryp_SPc 477..711 CDD:214473 76/268 (28%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855 19/84 (23%)
Tryp_SPc 136..385 CDD:214473 76/268 (28%)
Tryp_SPc 137..388 CDD:238113 78/269 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.