| Sequence 1: | NP_001341275.1 | Gene: | C1R / 715 | HGNCID: | 1246 | Length: | 719 | Species: | Homo sapiens | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001303385.1 | Gene: | CG10477 / 38679 | FlyBaseID: | FBgn0035661 | Length: | 272 | Species: | Drosophila melanogaster | 
| Alignment Length: | 270 | Identity: | 76/270 - (28%) | 
|---|---|---|---|
| Similarity: | 121/270 - (44%) | Gaps: | 49/270 - (18%) | 
- Green bases have known domain annotations that are detailed below.
| 
Human   468 PVNPVEQRQ------RIIGGQKAKMGNFPWQV---FTNIHGRG--GGALLGDRWILTAAHTLYPK 521 
Human   522 EHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYN---FEGDIALLELENSVTL 583 
Human   584 GPNLLPICLPDNDTFYD--LGLMGYVSGFGVMEEK---IAHDLRFVRLPVANPQACENWLRGKNR 643 
Human   644 MDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSW--GIGCSRG--YGFYTKV 704 
Human   705 LNYVDWIKKE 714 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| C1R | NP_001341275.1 | CUB | 41..152 | CDD:214483 | |
| FXa_inhibition | 175..203 | CDD:317114 | |||
| CUB | 207..316 | CDD:278839 | |||
| Sushi | 323..385 | CDD:306569 | |||
| Sushi | 390..461 | CDD:306569 | |||
| Tryp_SPc | 477..711 | CDD:214473 | 70/250 (28%) | ||
| CG10477 | NP_001303385.1 | Tryp_SPc | 39..264 | CDD:214473 | 70/250 (28%) | 
| Tryp_SPc | 40..267 | CDD:238113 | 72/252 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||