DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1R and mas

DIOPT Version :9

Sequence 1:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:431 Identity:99/431 - (22%)
Similarity:168/431 - (38%) Gaps:89/431 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   317 TTEIIKCPQPKTLDEF------TIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDD 375
            ||.....|:|....::      |:.........|..|  |..|.|.|     :.....|:.....
  Fly   665 TTTTTTTPRPHVYSKYVCGVKGTLRTGRSQALSFVSY--ARAKYGVQ-----RTARQMTSAAGYS 722

Human   376 GTWHRAMPRCKIKDCGQPRNLPN---GDFRYTTTMGVNTYKARIQYYCHE-----------PYYK 426
            ..::::..|..:.....|..:.|   ||...::::..|..::   |:.|:           .||:
  Fly   723 PNFNKSNERLVLGSAIVPIQIHNDKLGDLVESSSLQSNQLRS---YHNHQAQADQPDLVYPEYYQ 784

Human   427 MQTRAGSRESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPW 491
            .::..|.:.:..|                                 .:|.|::||:..:.|.:.|
  Fly   785 QRSLYGLQSNFSG---------------------------------RRRARVVGGEDGENGEWCW 816

Human   492 QVFTNIHGRG----GGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIR 552
            || ..|:...    |.||:|.:|:|||||.:   .:..:|..::.|.:|..::..  |.|:...:
  Fly   817 QV-ALINSLNQYLCGAALIGTQWVLTAAHCV---TNIVRSGDAIYVRVGDYDLTR--KYGSPGAQ 875

Human   553 RVSVHPDY--RQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEE 615
            .:.|...|  ....|...:.|||||:|.....|...:..:|||.....:..|....|:|:|.|.|
  Fly   876 TLRVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCLVCLPARGVSHAAGKRCTVTGYGYMGE 940

Human   616 --KIAHDLRFVRLPVANPQACENWLRGKN----RMDVFSQNMFCAGHPSLKQDACQGDSGGVFAV 674
              .|...:|...:|:.:...|   :|..|    ::.:...:.||||... ..||||||.||....
  Fly   941 AGPIPLRVREAEIPIVSDTEC---IRKVNAVTEKIFILPASSFCAGGEE-GHDACQGDGGGPLVC 1001

Human   675 RDPNTDRWVATGIVSWGIGCSRG--YGFYTKVLNYVDWIKK 713
            :|...  :...|:||||.||.|.  .|.|.|..:::.||.:
  Fly  1002 QDDGF--YELAGLVSWGFGCGRQDVPGVYVKTSSFIGWINQ 1040

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569 10/67 (15%)
Sushi 390..461 CDD:306569 11/84 (13%)
Tryp_SPc 477..711 CDD:214473 72/247 (29%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 73/250 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.