DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1R and CG13744

DIOPT Version :9

Sequence 1:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:272 Identity:84/272 - (30%)
Similarity:123/272 - (45%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   463 PVCGKPVNPVEQRQ-RIIGGQKAKMGNFPWQVFTNI-HGRGGGALLGDRWILTAAHTLYPKEHEA 525
            |.||.|.......| |||||:.|:...:|||....| ..:.||.|:....:.||||.:     :.
  Fly   126 PECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRIAEYQCGGVLISANMVATAAHCI-----QQ 185

Human   526 QSNASLDVFLGHTNVEEL------MKLGNHPIRRVSVHPDYR----QDESYNFEGDIALLELENS 580
            ...|.:.|:||..:.::|      :.:..|.:.:..:||.:.    |.:.|    |||||:|...
  Fly   186 AHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRY----DIALLKLAQP 246

Human   581 VTLGPNLLPICLPDNDTFYD---LGLMGYVSGFGVMEEKIAHD----LRFVRLPVANPQACENWL 638
            .:...::||||||.    |.   :|..|.::|:|..|..:.|.    |:...:|:.....|..|.
  Fly   247 TSFTEHILPICLPQ----YPIRLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWH 307

Human   639 RGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGY--GFY 701
            ..|.........||||||.....|||.|||||...:::  ..|:|..||.|.|.||...:  |.|
  Fly   308 ESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKE--RGRFVLVGITSAGFGCGVDHQPGIY 370

Human   702 TKVLNYVDWIKK 713
            ..|...|.||::
  Fly   371 HNVQKTVRWIQE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569
Sushi 390..461 CDD:306569
Tryp_SPc 477..711 CDD:214473 77/253 (30%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 77/253 (30%)
Tryp_SPc 142..383 CDD:238113 78/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6509
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.