DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1R and CG8586

DIOPT Version :9

Sequence 1:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:366 Identity:99/366 - (27%)
Similarity:153/366 - (41%) Gaps:72/366 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   388 KDCGQ-----PRNLPNGDFRYTTTMGVNTYKARIQ-YYCHEPYYK---MQTRAGSRESEQGVYTC 443
            :.|||     ||.|...:.  ....|::....||. ..|.:..|:   :..:....||...|   
  Fly   103 ESCGQNMECVPRKLCRDNI--INDSGISLINPRISPIQCSKSLYRCCAVDQKVDDSESPYLV--- 162

Human   444 TAQGIWKNEQKGEKIPRCLPVCGKPVN---PVEQRQRIIGGQKAKMGNFPWQV--FTNIHGRG-- 501
             .|..:|.:..|...|:.|    .|.|   |..:...|       .|.|||.|  ||   ||.  
  Fly   163 -KQANFKYKNCGYSNPKGL----IPDNDKFPYSEDVSI-------FGEFPWMVGIFT---GRQEF 212

Human   502 --GGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHP-------IRRVSVH 557
              ||.|:..|.::|.:|.|.        |.::|..:......:|..| |.|       |:.:.:|
  Fly   213 LCGGTLIHPRLVVTTSHNLV--------NETVDTLVARAGDWDLNSL-NEPYPHQGSRIKEIIMH 268

Human   558 PDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDND----TFYDLGLMGYVSGFGVME---E 615
            .::..:..||   |||||.|:..:.|.|::.|:|||..:    |...|.:..|.:|:|..|   :
  Fly   269 SEFDPNSLYN---DIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWGTKEAGSD 330

Human   616 KIAHDLRFVRLPVANPQACENWLRGKNRMDV---FSQNMFCAGHPSLKQDACQGDSGG-VFAVRD 676
            |:.|.|:.:.||:...:.|:..|| ..|::.   ...:..|||....| |.|:||.|. :|....
  Fly   331 KLEHVLKRINLPLVEREECQAKLR-NTRLEARFRLRPSFICAGGDPGK-DTCKGDGGSPLFCQMP 393

Human   677 PNTDRWVATGIVSWGIGCSRG--YGFYTKVLNYVDWIKKEM 715
            ...||:...||||||:.|:..  ...|..|.:...||.:::
  Fly   394 GEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKI 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569
Sushi 390..461 CDD:306569 18/79 (23%)
Tryp_SPc 477..711 CDD:214473 75/259 (29%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 76/252 (30%)
Tryp_SPc 197..430 CDD:214473 74/249 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.