DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1R and l(2)k05911

DIOPT Version :9

Sequence 1:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:482 Identity:130/482 - (26%)
Similarity:198/482 - (41%) Gaps:82/482 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   267 DQLQIYANGKNIGEFCGKQRPPD-------LDTSSNAVDLLFFTDES---GDSRGWKLRYTTEII 321
            |:..:...|:..|.:     |||       :|.:::..|...|.|.:   |:..|...:...|.:
  Fly   208 DREHVIPEGEVEGVY-----PPDVPRPEEPIDNANSVEDTPDFQDINTIEGNPPGADKKPEAEPV 267

Human   322 KCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDDGTWHRAMPRCK 386
            ..|..:.:       :.||         |:....||...|     ||..     |.|..|:|...
  Fly   268 GEPVEQPI-------STQP---------ASTIHPYQWPFG-----SFAG-----GQWPPALPTHP 306

Human   387 IKDCGQPRNL----PNGDF-RYTTTMGVNTYKARIQYYCHEPYYKMQTRA---GSRESEQGVYTC 443
            ....|.|..|    ||..: .:.||.||.:.| |.......|.....||.   .|..|.....|.
  Fly   307 PTTGGWPPPLPTHPPNHHYPTHPTTGGVPSTK-RTTPRPTSPARPTTTRRPTYPSYPSPVTTTTT 370

Human   444 TAQGIWKNEQKGEKIPRCLPV-CG--KPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRG--GG 503
            |.:.:.....:|      ||: ||  .||.|  .::||:||..|....|||.......|:.  ||
  Fly   371 TRRPVSGTSSEG------LPLQCGNKNPVTP--DQERIVGGINASPHEFPWIAVLFKSGKQFCGG 427

Human   504 ALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNF 568
            :|:.:..||||||.:  ....:...|:|...||..|:....:: .|..||:.....::..|....
  Fly   428 SLITNSHILTAAHCV--ARMTSWDVAALTAHLGDYNIGTDFEV-QHVSRRIKRLVRHKGFEFSTL 489

Human   569 EGDIALLELENSVTLGPNLLPICLPDNDT----FYDLGLMGYVSGFGVMEEKIAHD--LRFVRLP 627
            ..|:|:|.|...|.....:.|||||.:.:    .|. |.:..|:|:|.:.|.....  |:.|.:|
  Fly   490 HNDVAILTLSEPVPFTREIQPICLPTSPSQQSRSYS-GQVATVAGWGSLRENGPQPSILQKVDIP 553

Human   628 V-ANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWG 691
            : .|.:....:  |:.......::|.|||..:  :|:|.|||||...:.|..  |:...||||||
  Fly   554 IWTNAECARKY--GRAAPGGIIESMICAGQAA--KDSCSGDSGGPMVINDGG--RYTQVGIVSWG 612

Human   692 IGCSRGY--GFYTKVLNYVDWIKKEME 716
            |||.:|.  |.||:|.:.:.||.|.::
  Fly   613 IGCGKGQYPGVYTRVTSLLPWIYKNIK 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839 12/58 (21%)
Sushi 323..385 CDD:306569 13/61 (21%)
Sushi 390..461 CDD:306569 19/78 (24%)
Tryp_SPc 477..711 CDD:214473 75/244 (31%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 75/244 (31%)
Tryp_SPc 400..637 CDD:238113 76/246 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.