DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1R and Lrp4

DIOPT Version :9

Sequence 1:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens
Sequence 2:NP_727914.1 Gene:Lrp4 / 32552 FlyBaseID:FBgn0030706 Length:2009 Species:Drosophila melanogaster


Alignment Length:174 Identity:49/174 - (28%)
Similarity:70/174 - (40%) Gaps:51/174 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   156 DLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQAECSSELYTEASGYIS 220
            |:|||...:       .|.|...|||.:|.:.|||..||.|:.|..||:|         ..|.::
  Fly   564 DIDECQYLT-------SPVCSQKCHNTMGSFKCSCETGYILRPDLRSCKA---------LGGAMT 612

Human   221 SLEYPRSYPPDLR------CNYSIRVERGLTLHLKFLEPFDIDDHQQVHCPY------DQLQ-IY 272
            .|...|.   |:|      ..||..|:   .||    ....:|.|.:....:      |.:: :|
  Fly   613 LLVANRW---DIRRVTLSNNRYSAIVK---GLH----NAIALDFHHRKGLMFWSDVSTDVIKMVY 667

Human   273 ANGKNIGEFC--GKQRPPDLDTSSNAV----DLLFFTDESGDSR 310
            .||..:.:..  |.:.|..:     ||    ||||:|| ||..|
  Fly   668 MNGTRVRDVIKWGLESPGGI-----AVDWIHDLLFWTD-SGTRR 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114 12/27 (44%)
CUB 207..316 CDD:278839 29/123 (24%)
Sushi 323..385 CDD:306569
Sushi 390..461 CDD:306569
Tryp_SPc 477..711 CDD:214473
Lrp4NP_727914.1 LDLa 267..301 CDD:238060
LDLa 306..340 CDD:238060
LDLa 347..390 CDD:238060
LDLa 397..431 CDD:238060
LDLa 442..476 CDD:238060
LDLa 480..521 CDD:238060
FXa_inhibition 576..604 CDD:291342 12/27 (44%)
LY 634..671 CDD:214531 8/43 (19%)
NHL <656..793 CDD:302697 17/56 (30%)
LY 680..714 CDD:214531 13/32 (41%)
NHL repeat 681..722 CDD:271320 12/31 (39%)
NHL repeat 726..760 CDD:271320
LY 761..803 CDD:214531
NHL repeat 769..793 CDD:271320
FXa_inhibition 882..912 CDD:291342
LY 946..985 CDD:214531
NHL <967..1142 CDD:302697
LY 988..1030 CDD:214531
NHL repeat 998..1037 CDD:271320
NHL repeat 1038..1080 CDD:271320
NHL repeat 1084..1119 CDD:271320
FXa_inhibition 1185..1220 CDD:291342
NHL 1260..>1445 CDD:302697
NHL repeat 1260..1296 CDD:271320
NHL repeat 1302..1337 CDD:271320
NHL repeat 1345..1383 CDD:271320
FXa_inhibition <1499..1525 CDD:291342
LY 1600..1640 CDD:214531
LY 1643..1686 CDD:214531
LY 1688..1729 CDD:214531
FXa_inhibition 1801..>1825 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.