DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1R and CG31267

DIOPT Version :9

Sequence 1:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:264 Identity:66/264 - (25%)
Similarity:109/264 - (41%) Gaps:71/264 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   477 RIIGGQKAKMGNFPWQV-FTNIHGRG--GGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHT 538
            ||:||:::.:...|:.| ..|.:|..  .|:::.|:|::|||..|              ..|...
  Fly    44 RIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCL--------------AGLRKN 94

Human   539 NVEELMKLGNH--------PIRRVSVHPDYRQDESYNFEGDIALLELE-----NSVTLGPNLLPI 590
            ||:.:....||        .:..:.:|.::   :|..:..||||::..     :.||....:.|:
  Fly    95 NVQVVTTTYNHWGSEGWIYSVEDIVMHCNF---DSPMYHNDIALIKTHALFDYDDVTQNITIAPL 156

Human   591 -CLPDNDTFYDLGLMGYVSGFGVMEEKIAHD----LRFVRLPVANPQACENWLRGKNRMDVFSQN 650
             .|.|.:|   |.:.||.|      .:|..|    |:.:.:....|:.|.....|...:||    
  Fly   157 EDLTDGET---LTMYGYGS------TEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDV---- 208

Human   651 MFCAGH----PSLKQDACQGDSGGVFAVRDPNTD-RWVATGIVSWGIGCSRGYGF---YTKVLNY 707
                ||    ..:...||.||:||      |..| |....|:.:||:.|  ||||   :.::..|
  Fly   209 ----GHLCAVGKVGAGACHGDTGG------PIVDSRGRLVGVGNWGVPC--GYGFPDVFARISFY 261

Human   708 VDWI 711
            ..||
  Fly   262 YSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569
Sushi 390..461 CDD:306569
Tryp_SPc 477..711 CDD:214473 64/262 (24%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 64/262 (24%)
Tryp_SPc 45..268 CDD:238113 65/263 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.