DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1R and CG42694

DIOPT Version :9

Sequence 1:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:541 Identity:98/541 - (18%)
Similarity:176/541 - (32%) Gaps:150/541 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   269 LQIYANGKNIGEFCG---------KQRPPDLD------------------------TSSNAVDL- 299
            ||.:.|.|.:.::||         |.|.|...                        :::..:|: 
  Fly    14 LQSHVNSKFLDDYCGAPISNQSITKLRQPQAGWLAHISNGTHVLCSGSLISKQFVLSAAQCIDVH 78

Human   300 --LFF---TDESGDSRGWKLRYTTEIIKCP--QPKTLDEFTIIQNLQPQYQFRDYFIATC-KQGY 356
              ||.   ...:..|..|   ||...:..|  ..|.|.....:..|.....:.|:....| ....
  Fly    79 GKLFVQLGVSNATKSPHW---YTVSNVVIPSHSGKRLQRDIGLLKLSQSVDYNDFVYPICIALNT 140

Human   357 QLIEGNQVLHSFTAVCQDDGTW-------------HRAMPRCKIKDCGQ--PRNLPNGDFRYTTT 406
            ..::..::|.:||.     ..|             ..:..|||:...|.  |:.:.....:...:
  Fly   141 NTLDMVKILQNFTT-----SAWLSKNKNPQTIVLSQLSRDRCKLNLSGNVTPKEICAASLQRNNS 200

Human   407 MGVNTYKARIQ-----------------------YYCHEP--YYKMQTRAGSRESEQGVYTCTAQ 446
            ..:::..|..|                       .:|.||  |..:....|..|:....|..|..
  Fly   201 CFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWCSEPAIYIDVAECVGWIETVVQQYDGTDS 265

Human   447 GIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRG---------- 501
            ......:..:.:...|...||.:                      .:|.|..|..          
  Fly   266 RAVATPEVNQHLKHSLSRMGKNI----------------------LLFKNCRGNSLQSKLRARIY 308

Human   502 GGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESY 566
            |...:|..|.:|....:...:...:|..||.|.|..|    |.......::.|..||::.:|   
  Fly   309 GPNYIGQGWFITHRFVITNAKDLPESAESLYVGLPGT----LRSYDEFSVQSVFKHPEFSED--- 366

Human   567 NFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRL--PVA 629
             ::.|||||.:...|.:| :|.|||:...:...:|........|..::  .|:.::.||.  .:|
  Fly   367 -YKNDIALLRVHQRVAMG-HLRPICMLLKENQQELAKSSPPISFDYVQ--TANRIQVVRKIDALA 427

Human   630 NPQACENWLRGKNRMDVFSQNMFCAGHP--SLKQDACQGDSGGVFAVRDPNTDR-W-VATGIVSW 690
            :|:.|.|.|     :.....|..|...|  :::::|.:   ||:..:|...:.: | :..||.|:
  Fly   428 DPRICTNRL-----LKTIEPNQLCVVVPPETVQKNATR---GGILGLRMMYSGKEWLILFGISSY 484

Human   691 GIGCSRGYGFYTKVLNYVDWI 711
            .   ......:|.|:.:..||
  Fly   485 S---HNDIEVFTNVMEHTQWI 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839 14/85 (16%)
Sushi 323..385 CDD:306569 10/77 (13%)
Sushi 390..461 CDD:306569 12/97 (12%)
Tryp_SPc 477..711 CDD:214473 52/249 (21%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 30/217 (14%)
Tryp_SPc 46..253 CDD:214473 29/214 (14%)
Tryp_SPc 319..505 CDD:304450 48/206 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.