DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TJP1 and pyd

Sequence 1:XP_016878010.1 Gene:TJP1 HGNCID:11827 Length:1878 Species:Homo sapiens
Sequence 2:NP_001246998.1 Gene:pyd FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster

Alignment Length:2359 Identity:620/2360 (26%)
Similarity:923/2360 (39%) Gaps:653/2360 (28%)


Human    20 RERSGDKMK-YQKYLTVLQMAIGVTPSNRGSLLPLKRKLWVTPSSENPNGATSSVSQGKPSLRRI 83
            |||.||:.: |.:.:..|..|:|            ||     ...:|.:....:.|....|.|| 
  Fly   190 RERGGDRDRPYIRNVDDLLQALG------------KR-----DGGDNNSNLLETASTHSSSQRR- 236

Human    84 KGRLHRSKSLDSMDFCELTSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIV 148
                 |.|..|              ...||.|||.:.|.||:|||||:|||||||||.:|:.||.
  Fly   237 -----RFKKGD--------------RTTWEYHTVAVTRVPGYGFGIAVSGGRDNPHFANGDPSIA 282

Human   149 ISDVLKGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPD 213
            :||||||||||.:||.|||:..|||||::|||:|.|||.||.||...::.::|:    :|::   
  Fly   283 VSDVLKGGPAEDRLQVNDRIISVNGVSLENVEYATAVQVLRDSGNTVQLVVKRR----VPLN--- 340

Human   214 PEPVSDNEEDSYDEEIHDPRSGRSGVVNRRSEKIWPRD-RSASRERSLSPRSDRRSVASSQPAKP 277
              |:  |...:...: |.......|::...|..:.|.. .|.|:..||    :...|.::...:|
  Fly   341 --PI--NAAGAVQHQ-HSHSLSSVGLMANGSGGVAPTPITSLSQPNSL----NSSLVQNASSGQP 396

Human   278 TKVTLVKSRKNEEYGLRLASHIFVKEIS---QDSLAARDGNIQEGDVVLKINGT-VTENMSLTDA 338
            .||||.|..|.::||:.|...:||||||   ::.|.|...::||||::.:|:.| ..:.|||.:|
  Fly   397 IKVTLTKGGKKDDYGVVLGCRLFVKEISSKAREQLNANGYSLQEGDIITRIHNTNCGDTMSLKEA 461

Human   339 KTLIERSKGKLKMVVQRD-ERATLLNVPDLSDSI-HSAN----ASERDDISEIQSLASDHSGRSH 397
            |.:|:..|.:|.:||.|| ...|.::..:|::|. |.|:    |:.:..:|...|     |..:.
  Fly   462 KKIIDGCKERLNLVVLRDITNQTAVSQLNLNNSASHQASGNIYATHQPQVSGCSS-----SNNNL 521

Human   398 DRP--PRRSRSRSPDQRSEPSDHSRHSPQQPSNGSLRSRDEERISKPGAVSTPVKHADDHTPKTV 460
            :.|  |..:...|.:...:|...:.:.|....||   ..||:                       
  Fly   522 EDPYLPGGASYSSQNLYVQPPTRTSNGPNINGNG---LNDEK----------------------- 560

Human   461 EEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRP------------ 513
                    ...||......|:...|....:|.||:|:.|   .|...|...||            
  Fly   561 --------SNLTPRGRSRGPIMDGVSLQQLDRPVTPTRG---RSAAIDEPPRPPPPRGSSGGAAQ 614

Human   514 -----------------SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQIL 561
                             ..:.:.|:|..|||:||.|||:.||||..|...|||:.:||..||:||
  Fly   615 EDFYSSRRQLYEERQSAEPRFISFQKEGSVGIRLTGGNEAGIFVTAVQPGSPASLQGLMPGDKIL 679

Human   562 RVNNVDFTNIIREEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPY 626
            :||::|...:.|||||||||.|.  :.:.::.|..|:.|..:|.:..||||:|:|||..:..|..
  Fly   680 KVNDMDMNGVTREEAVLFLLSLQ--DRIDLIVQYCKEEYDEVVTNQRGDSFHIKTHFHCDNPSKG 742

Human   627 GLSFNKGEVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPK---TAG 688
            .::|..|:||||:|||:||.:|||..::||:.|:|::||:||||:|||:||:.|:...|   .|.
  Fly   743 EMAFKAGDVFRVIDTLHNGVVGSWQVLKIGRGHQEMQRGVIPNKSRAEELATAQFNATKKEMNAN 807

Human   689 GDRADFWRFRGL--RSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAR 751
            ..|.:|:|.|..  |.||...|::.:|:......:|||||||||||..||:|||.:|||::|:||
  Fly   808 ESRGNFFRRRRSTHRRSKSLSRENWDDVVFSDSISKFPAYERVVLRHPGFVRPVVLFGPVSDLAR 872

Human   752 EKLAREEPDIYQIAKSEP-RDAGTDQRSSG---IIRLHTIKQIIDQDKHALLDVTPNAVDRLNYA 812
            |:||::.||.:    |.| :|......:||   |:||..|:.::|:.||||||:|||||||||||
  Fly   873 ERLAKDFPDKF----STPLQDDDKSAATSGKCRIVRLSNIRDVMDRGKHALLDITPNAVDRLNYA 933

Human   813 QWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYG 877
            |:||:|:||..|||..:|.:|..|...:.||::||.|:..||.:...|:|:|.|.| |..:.||.
  Fly   934 QFYPVVIFLKTDSKHVIKQLRHGLPKAAHKSSKKLLEQCQKLERVWSHIFSTQIAL-SDEESWYR 997

Human   878 ALKEAIQQQQNQLVWVSEGKADGATSDD--LDLHDDRLSYLSAPGSEYSMYSTDSRHTS-----D 935
            .|:::|..||:..||:||.|...:.|||  ..:...||||.|:|.|:..:....|...|     .
  Fly   998 KLRDSIDLQQSGAVWMSESKPVESLSDDFLFPMTTSRLSYASSPESDLELSPGPSASLSLGNLPQ 1062

Human   936 YEDTDTEGGAYTDQELDETLNDEV--GTPPESAITRS----SEPVRE---DSSGMHHENQTYPPY 991
            .....::....|:|:..:...|.:  |.||...:...    :.|.|.   |||.........||.
  Fly  1063 LVKASSDPSIATNQDNLDRDRDIIGEGLPPPYTVPYDHAVPANPNRRQTMDSSKYSIYGTNVPPQ 1127

Human   992 SPQ---------AQPQPIHRIDSPGFKPASQQKAEASSPVPYLSPETNPASSTSAVNHNVNLTNV 1047
            ..|         .:||.::.|::|...|...::::         |...|.:::.:.:.|..|...
  Fly  1128 QQQPGVGGDTAAVRPQSLYGINAPDLPPRIDRQSK---------PGDIPLNTSGSSSRNGTLGRS 1183

Human  1048 RLEEPTPAPSTSYSPQADSLRTPS---TEAAHIMLRDQEPSLSSHVDPTKVYRKDPYPEEMMRQN 1109
            ..|............||:.:...:   :.||..:.|.|:....:|..          .|...|.|
  Fly  1184 AQERLFGKAVVQDDVQAEYITRNALVGSGAAETLDRQQQQQQQTHAS----------LERQARLN 1238

Human  1110 HVLKQPAVSHPG------------------------------HRPD---KEPNLTYEPQLPYVEK 1141
            ..||...|...|                              :.||   ..||....|..|..:.
  Fly  1239 AQLKANGVGAGGGGASTYDSVSSYDSYNNTQMAMQNLGRLGPNAPDDLKSVPNANGRPLPPTGQS 1303

Human  1142 QA-------SRDLEQPTYRYESSS-----YTD-QFSRNYEHR-----------LRYEDRVPMYEE 1182
            ..       .|....|......||     |.| ..|||.:.|           |....|.|:.|.
  Fly  1304 HEYGRTPHDHRSFGGPNDLNRQSSPGRPHYHDMNASRNIDPRNGTPQRPSNLGLESSPRKPLVET 1368

Human  1183 QWSY--YDDKQ--------------PYPSRPPFDNQHSQDLDSRQHPEESSERGYFPRFEEPAPL 1231
            :..|  |....              |:...||.:..:.|...:......|:..|.|.....|.|.
  Fly  1369 KTDYGKYSRNNSVTQADYTKLPKTAPHGVVPPPNVSNGQGQMNGSGTPSSNGSGPFKPVPPPKPK 1433

Human  1232 SY---------------------DS-RPR----YEQAPRASALRHEEQPAPGYDTHGRLRPEAQP 1270
            :|                     || .||    :...|..|...:.:|..||..::|.::|    
  Fly  1434 NYRPPVQSGGSSGSGGTTPWENGDSGSPRSPNGFYYPPTPSHHHYGQQATPGSPSNGHMQP---- 1494

Human  1271 HPSAGPKPAESKQYFEQYSRSYEQVPP-------QGFTSRAGHFEPLHGAAAVPPLIPSSQHKPE 1328
                 |.|.:.:..:...:.:|.|.||       .|:.....|:   :|.:...|.|  :.|:  
  Fly  1495 -----PPPQQQQPTYGGSNGNYGQAPPPQSYPQANGYNGNGHHY---NGGSGTGPYI--APHR-- 1547

Human  1329 ALPSNTKPLPPPPTQ--------TEEEEDPAM----KPQSVLTRVKMFENKRSASLETKKDVNDT 1381
            .:|.....|||...:        :.|:...|.    |||...|.............:.:.|  |.
  Fly  1548 GMPPPIGNLPPHTPERHALDLAGSREQRGSAFELYRKPQIGATAGHHHNMSEMEPYDERYD--DY 1610

Human  1382 GSFKPPEVASKPS---------GAP--------------IIGPKPTS------QNQFSEHDKTLY 1417
            .:..||  |:.||         .||              ..|...||      :.|:|:|.:..|
  Fly  1611 YNMPPP--AAHPSQGHHMQRSRSAPRYPHERPPHAQDPNYYGHYGTSRGHSQPRQQYSQHHQQQY 1673

Human  1418 ------RIPEPQKPQLKPPEDIVRS--------------------NHYDPEEDEEYYRKQLSYFD 1456
                  .:..|..|..|..:.:::|                    :..:||...:..|:|.|..:
  Fly  1674 YDDHGLEMGPPPLPPHKKKKSVLKSPLVALKNALLKSTRPLRRMNSMVEPERKPKGLRRQQSMLE 1738

Human  1457 R---------------RSFENKPPAHIAASHLSEPAKPAHSQNQSNFSSYSSKFLGS-------- 1498
            |               ..||.:  ||.....:...::.|:.|...:::....:.:.|        
  Fly  1739 RGVQRPYYPDEYPTYPAGFEER--AHGGQGMMQPHSQDAYYQRGGHYAPQQQEMMNSTYQNLEGE 1801

Human  1499 ----------------------YTSYD-YLKRNVKWGKPPEADGVDRSFGE------KRYEPIQA 1534
                                  |..|| |..|.....:..:|:....|.|.      :|:....|
  Fly  1802 DIYGNIGNTVPRMPHHQDNGYGYDQYDLYANRACIDLERRQAEAAAASGGRNGRRIVRRHSTTTA 1866

Human  1535 ----TPPPP------------------------PLPSQYAQPSQPVT--------SASLHIHSKG 1563
                .|.||                        .||.|...||..|.        :|:.....:.
  Fly  1867 DRGGNPGPPRRPMISPGYEQDPQEIYQTRNGAYMLPDQRRAPSSEVMTRRRFYPGAANEQTEEEP 1931

Human  1564 AHGEGNSVSLDFQ-NSLVS--------------------KPDPPPSQ----NKPATFRPPNREDT 1603
            .:.....:..:.| |.|..                    .|....||    |..|.::  :|.:.
  Fly  1932 LYQSRREMQREMQRNHLYQSKREMQERISQGKRDMEREFSPQSSSSQSEASNSEAIYQ--SRREA 1994

Human  1604 AQAAFYPQKSFPDKAPVNGTEQTQKTVTPAY----NRFTPKPY---------------TSSARPF 1649
            .::|...:....|:......|.......|.|    ....|.|.               |...:..
  Fly  1995 KESALKTRSQLRDQIYQTRREALDSMAEPIYVSKRGMGRPAPIYETREESILQSRENETDEKKEK 2059

Human  1650 ERKFESPKFNHNLLPSE-----TAHKPDL------------------------------------ 1673
            |.|.|..:...|..|.|     |..:.||                                    
  Fly  2060 ECKTEQIQVEINAQPEEQIEDSTLSRSDLQKSSDTVIENPARAPLVQDEVDDDEEEEVQDQRDPA 2124

Human  1674 -SSKTPTSPKTLVKSH-------------------------SLAQPPEFDSGVETFSIHAEKPKY 1712
             ||...|...|.::::                         .||.||   :.|:..:..:.:..:
  Fly  2125 ESSADQTEQPTAIENNLHNEGMVEQSQNDSDDVFEAADKVSPLAPPP---APVQPPTPRSGRAPF 2186

Human  1713 QINNI--STVP--------------------KAIPVSP-----------------SAVEEDEDED 1738
            .|:||  .|.|                    .::||.|                 ..|......:
  Fly  2187 HISNILKRTAPPPSSPIGDSCTSIETQYTSQASLPVGPPNATSTPFSSSMSLPIAGPVNNQPSAN 2251

Human  1739 GHTVV-----ATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVC--RDNSIL--PP 1794
            |....     :|:||.|:||||.|:.....||:.||.||||.||.|||||.|.  |....:  ||
  Fly  2252 GRFPTLPREPSTSRGFFDSNGGTLADKLWHVSLQIPPGAIPAGVRQEIYFTVSDPRMGQAVGGPP 2316

Human  1795 LDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLP 1859
            ||.|.|||:|||||||||.||:||.||.|.:||||..|. ....|||::||.......|.|..||
  Fly  2317 LDMENGETMLSPLVMCGPQGLEFLVPVTLNIPHCAGRTA-SLGLALKATDSEKNLHTEWDNIDLP 2380

Human  1860 GDPNYLVGANCVSVLIDHF 1878
            .:    ..|:.|||.:|||
  Fly  2381 SN----AAAHTVSVKVDHF 2395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TJP1XP_016878010.1 None
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492 54/85 (64%)
PDZ_signaling 396..477 CDD:238492 34/81 (42%)
PDZ_signaling 633..710 CDD:238492 37/79 (47%)
SH3_ZO 729..790 CDD:212793 31/61 (51%)
GuKc 831..1007 CDD:214504 85/181 (47%)
ZU5 2263..2351 CDD:279170 53/88 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115523777
eggNOG 1 0.900 E1_KOG3580
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 605 1.000 Inparanoid score I924
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1175136at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T608289
orthoMCL 1 0.900 OOG5_129845
Panther 1 1.100 O PTHR13865
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3326
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.