DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TFRC and CG10081

Sequence 1:NP_001121620.1 Gene:TFRC HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_611418.1 Gene:CG10081 FlyBaseID:FBgn0034441 Length:875 Species:Drosophila melanogaster

Alignment Length:893 Identity:152/894 (17%)
Similarity:272/894 (30%) Gaps:364/894 (41%)


Human    13 FGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGTIAVIVFF 77
            |..:|.|.:        .||:.|  |.:::.|.....::.:.:...|              |:|.
  Fly   173 FDSQPTSPS--------TGDDGH--MVVSILEVLRVISSRRKSFEHP--------------IIFL 213

Human    78 LIG-------FMIGYLGYCKGVEPKTECERLAGTESPVRE---EPGEDFPAARRLYWDDLKRKLS 132
            :.|       ...|::.|.|..:.......|....|..||   :.|.:.|...::|.|..|...|
  Fly   214 INGSEENSLQASHGFIAYHKWAKNCKAVINLDAAGSGGRELMFQSGPNNPWLVKIYKDGAKHYFS 278

Human   133 EKLDSTDF-TGTI---------------------KLLNENSY---------VPREAGSQKDENLA 166
            ..:....| ||.:                     :.:|...|         :||.|.....:||.
  Fly   279 TTMAEEIFQTGLVPSYTDFDIFVEYGNLIGLDIGQCINGFVYHTKYDRIDVIPRAALQNTGDNLL 343

Human   167 LYVENQFREFKLSKVWRDQHFVKIQVKDSAQN---SVIIVDKNGRLVYLVENPGGYVAYSKAATV 228
            ..|:.      ||..        .:::|.:.|   :.|..|..|  :||       ::||     
  Fly   344 GLVQT------LSNA--------SELRDLSANPTGNTIFFDVLG--LYL-------ISYS----- 380

Human   229 TGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVA-NAESLNAIGVLIYMDQ------- 285
                  |:.|.|.:    |.....:|:::....:..|||.: ::|.:.:..:|:.:.|       
  Fly   381 ------ADVGVKLN----YAVAAAAIILIYISLLRIAEKSSVSSEQILSTFILVLVVQLIAFVLA 435

Human   286 TKFPIVNA--------ELSFFGHAHLGTGDPYTPG-----FPSFNHTQFPPSRSSGLPNIPVQTI 337
            ...|::.|        .||:|....|..|....|.     .||:.:.:        |.|....:.
  Fly   436 LALPLLVAYGLDKYGLSLSYFATPSLLIGLYICPSLLGLTLPSYIYLK--------LANTEKVSF 492

Human   338 SRAAAEKLFG------------NMEGDCPSDWKTDSTCRMVTSESKNVKLTV-------SNVLKE 383
            ::.....|.|            |..|...:...|.:....|...:.|:..|:       :.:||.
  Fly   493 AQQVQLALHGHAAVLSILCIAINYYGLRTTYVITWTLAFYVIPLAFNLLTTLHDRGYSWTGILKI 557

Human   384 IKI--------------------LNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSGVGTALLLK 428
            :::                    :..|||   ...||  :::|          |.:.:||.|.:.
  Fly   558 VQVAPFMYNSYLFYCFIVILTPMMGRFGV---DTNPD--LIIG----------ALTALGTILSMG 607

Human   429 LAQMFSDMVLKDGF-------------------------QPSRSI----------IFASWSAGDF 458
            ...:..:|..:.||                         :|..::          ||..:.    
  Fly   608 FLILLVNMSRRSGFVLIGLLAVTAAGVYIASSTDIGFPYRPKTNVQRVPYLQVRRIFYEYD---- 668

Human   459 GSVGATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYT------LIEKTMQNVKHPV 517
            |:|...|  .|||.:|.         |:..|         :|||.:      |:..|....|:.:
  Fly   669 GTVSKDE--SGYLFNLQ---------DRRGL---------TPLLESNVDLTGLVNMTSDCAKYMM 713

Human   518 TGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPE 582
            .|..|| |..|...:|                                  |||        .:|.
  Fly   714 CGMPLY-DHRWVEAME----------------------------------TTM--------WLPR 735

Human   583 LNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARG 647
            .|.|...|..:                               |.|....:...|.::|:.:    
  Fly   736 KNPVWTPAEPI-------------------------------LKQLNKTVLADGQTVQFEF---- 765

Human   648 DFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPAL 712
                   .|||    ::.|..|:..  |:.|:...:.||..|::....|: |:::..|       
  Fly   766 -------ELTT----SDHTSIFISP--NEDVIISNWSFLKEYLTTNSPPY-HIYYSFG------- 809

Human   713 LENLKLR-----KQNNGAFNETLFRNQLALATWTIQG------AANAL 749
            ::|..||     |:.:|.:...||:..:......::|      .||:|
  Fly   810 IDNTPLRFHIELKKADGVYTVPLFQMGIGAHYMHVKGDDESIRLANSL 857

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TFRCNP_001121620.1 Mediates interaction with SH3BP4. {ECO:0000269|PubMed:16325581} 1..67 9/54 (17%)
Endocytosis signal 20..23 0/3 (0%)
Stop-transfer sequence 58..61 1/3 (33%)
PA_TfR 201..377 CDD:239043 38/209 (18%)
M28_TfR 385..610 CDD:193572 44/286 (15%)
Ligand-binding 569..760 34/193 (18%)
TFR_dimer 642..750 CDD:282153 24/120 (20%)
Cell attachment site, required for binding to transferrin 646..648 0/2 (0%)
CG10081NP_611418.1 M28_Fxna_like 72..379 CDD:193497 45/253 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.