DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TFRC and CG10073

Sequence 1:NP_001121620.1 Gene:TFRC HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_001261090.1 Gene:CG10073 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster

Alignment Length:447 Identity:83/448 (19%)
Similarity:148/448 (33%) Gaps:122/448 (27%)


Human   233 VHANFGT-KKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYM------------- 283
            |.:.|.| |....|  .|:..::....:.||...|:........|.|.|::.             
  Fly     5 VRSRFDTCKNKISD--EPIEDAVRSASSKKIKNQEQYLRGPWYLATGFLLFWALLFSAVVLPLFY 67

Human   284 ---------DQTK--FPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTI 337
                     |.:|  |....|:.:.:..|.:||                   :..|..|...:|:
  Fly    68 RIPTGLTIEDASKGVFIAERAQSNLYKLAEIGT-------------------KVVGSDNNENKTV 113

Human   338 SRAAAEKLFGNMEGDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDH- 401
            .....  |...::.:|..|: .|....:.......:..|:.|:.:.::  ||  |||  :.|.: 
  Fly   114 DYLMG--LVNEIQENCLDDY-FDIEVDLQEVSGSYIHWTMVNMYQGVQ--NI--VIK--LSPKNT 169

Human   402 ----YVVVGAQRDA--WGPGAAKSGVGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSA----- 455
                |::|.:..|:  ..|.|..:|.....:|::.::...  .|...:  ..::|....|     
  Fly   170 TSTTYLLVNSHFDSKPTSPSAGDAGQMVVAILEVLRVMCS--TKQAIR--HPVVFLLNGAEENPL 230

Human   456 -GDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPV-- 517
             ...|.:...:|.:        .....:|||.|..|.|:......|....|:||..:|..|.:  
  Fly   231 QASHGFITQHKWAK--------NCKVVLNLDAAGNGGSDIVFQTGPNSPWLVEKYKENAPHYLAT 287

Human   518 --------TGQFLYQDSNWASKVE---KLTLDNAAF--------PFLAYSGIPAVSFCFCEDTDY 563
                    || .|..|:::|..|:   .:.||.|.|        .:..:|.||..|         
  Fly   288 TMAEEIFQTG-ILPSDTDFAIFVKYGNLIGLDMAKFINGFAYHTKYDQFSNIPRGS--------- 342

Human   564 PYLGTTMDTYKELIERIPELNKVARAAA---------EVAGQFVIKLTHDVELNLDY 611
              :..|.|....|:..|....::....|         :|.|.:.|..|....:.|:|
  Fly   343 --IQNTGDNLLGLVRSIANSTELDNTEAYATGHAIFFDVLGLYFISYTESNGVILNY 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TFRCNP_001121620.1 Mediates interaction with SH3BP4. {ECO:0000269|PubMed:16325581} 1..67
Endocytosis signal 20..23
Stop-transfer sequence 58..61
PA_TfR 201..377 CDD:239043 27/169 (16%)
M28_TfR 385..610 CDD:193572 54/268 (20%)
Ligand-binding 569..760 11/53 (21%)
TFR_dimer 642..750 CDD:282153
Cell attachment site, required for binding to transferrin 646..648
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:193497 67/359 (19%)
NrfD 398..638 CDD:304401 83/448 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.