DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TFRC and CG10062

Sequence 1:NP_001121620.1 Gene:TFRC HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_001261089.1 Gene:CG10062 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster

Alignment Length:343 Identity:68/344 (20%)
Similarity:124/344 (36%) Gaps:85/344 (25%)


Human   309 YTPGFPSF-------------NHTQFPPSRSSGLPNIPVQTISRAAAEKLF----------GNME 350
            |.|.|..|             ||...|.:||....: |...|::.|.:.|.          |:|.
  Fly    23 YAPAFFGFWLVLYLSLVNTQMNHMPRPLTRSDEASH-PNSFIAQRAEDTLIELTRIGPRVVGSMA 86

Human   351 GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKI--------------LNIFGVIKGFV---- 397
            .:       :|....:.:|...|:..:|::| ||::              :|::..|:..|    
  Fly    87 NE-------ESAVEFLRAEVAKVESEMSDLL-EIEVDVQQASGAYMHWEMVNMYQGIQNVVVKLS 143

Human   398 ----EPDHYVVVGAQRDA--WGPGAAKSGVGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAG 456
                ..::|:::.:..|:  ..|||...|.....:|::.:    ::.|.|...:..|:|....|.
  Fly   144 EKNSTNENYLLINSHYDSVPGSPGAGDDGSMVVTMLEVMR----VIAKSGDPLAHPIVFLFNGAE 204

Human   457 DFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHP---VT 518
            :.....:..::..:..:.:.||.  ||||.|..|.......:.| .:..:....:||.||   ..
  Fly   205 ENPLQASHAFITQHKWAKNCKAL--INLDSAGSGGREILFQSGP-NHPWLMNYYRNVPHPFANTL 266

Human   519 GQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPEL 583
            .:.|:|.....|       |.....|..|.|:|.:      |..|.:.|....|      :...:
  Fly   267 AEELFQAGYIPS-------DTDFRIFRDYGGVPGL------DMAYIFNGYVYHT------KYNRI 312

Human   584 NKVARAAAEVAGQFVIKL 601
            |...||:.:..|..|:.|
  Fly   313 NAFPRASFQHTGDNVLSL 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TFRCNP_001121620.1 Mediates interaction with SH3BP4. {ECO:0000269|PubMed:16325581} 1..67
Endocytosis signal 20..23
Stop-transfer sequence 58..61
PA_TfR 201..377 CDD:239043 18/91 (20%)
M28_TfR 385..610 CDD:193572 46/245 (19%)
Ligand-binding 569..760 7/34 (21%)
TFR_dimer 642..750 CDD:282153
Cell attachment site, required for binding to transferrin 646..648
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 59/307 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.